
원본
Thermo Fisher Scientific FRMD1 Polyclonal Antibody
상품 한눈에 보기
FRMD1 단백질을 인식하는 Thermo Fisher Scientific의 토끼 폴리클로날 항체입니다. Western blot에 최적화되어 있으며 인간 단백질과 100% 서열 상동성을 가집니다. 합성 펩타이드를 면역원으로 사용하였고, 액상 형태로 제공됩니다. 연구용으로만 사용 가능합니다.
- 카탈로그번호
- PA546467
- 판매단위
- pk
카탈로그
1개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
마지막 업데이트 2025. 08. 01. 오후 11:15
카탈로그 번호 · 상품 설명출고판매가담기
Thermo Fisher Scientific PA546467 FRMD1 Polyclonal Antibody 100 ul pk판매 단위 pk ·
재고 확인 필요
630,500원VAT 포함 693,550원
Thermo Fisher Scientific · Thermo Fisher Scientific FRMD1 Polyclonal Antibody
Applications
Western Blot (WB)
- Tested Dilution: 1 µg/mL
Product Specifications
| 항목 | 내용 |
|---|---|
| Species Reactivity | Human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | Synthetic peptide directed towards the N-terminal of human FRMD1 (aa 95-144) |
| Conjugate | Unconjugated |
| Form | Liquid |
| Concentration | 0.5 mg/mL |
| Purification | Affinity Chromatography |
| Storage Buffer | PBS with 2% sucrose |
| Contains | 0.09% sodium azide |
| Storage Conditions | -20°C, Avoid Freeze/Thaw Cycles |
| Shipping Conditions | Wet ice |
| RRID | AB_2606640 |
Product Specific Information
- Peptide sequence: FGLCVVRNNEYIFMDLEQKLSKYFSKDWKKERNEGNEKPRAPFVAFLRVQ
- Sequence homology: Human: 100%
Target Information
The function of this protein remains unknown.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
Thermo Fisher Scientific 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.
