
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-ADAM33 Antibody
상품 한눈에 보기
사람 ADAM33 단백질을 인식하는 토끼 폴리클로날 항체로, ADAM metallopeptidase domain 33 연구에 적합합니다. PrEST 항원을 이용해 친화 정제되었으며, IHC 등 다양한 응용에 사용 가능합니다. 40% 글리세롤, PBS 완충액에 보존됩니다.
- 카탈로그번호
- HPA067152-xxx (2개 옵션)
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA067152-100 Anti-ADAM33 Antibody, ADAM metallopeptidase domain 33 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA067152-25 Anti-ADAM33 Antibody, ADAM metallopeptidase domain 33 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-ADAM33 Antibody
Anti-ADAM33 Antibody
Target: ADAM metallopeptidase domain 33
Supplier: Atlas Antibodies
Product Description
Polyclonal antibody against human ADAM33 protein.
Affinity purified using the PrEST antigen as affinity ligand.
Alternative Gene Names
C20orf153, dJ964F7.1, DKFZp434K0521
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | ADAM metallopeptidase domain 33 |
| Target Gene | ADAM33 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Epitope Sequence | NSAGDAHGNCGQDSEGHFLPCAGRDALCGKLQCQGGKPSLLAPHMVPVDSTVHLDGQEVTCRGALALPSAQLD |
| Verified Species Reactivity | Human |
| Interspecies Identity | Mouse ENSMUSG00000027318 (64%), Rat ENSRNOG00000021242 (64%) |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative |
| Purification Method | Affinity purified using PrEST antigen as affinity ligand |
Material Safety Data Sheet (Sodium Azide)
Recommended Applications
- Immunohistochemistry (IHC)
- Other applications to be optimized by the user
Notes
- Gently mix before use.
- Optimal concentrations and conditions should be determined by the user.
Additional Resources
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



