
Atlas Antibodies Anti-ADAM33 Antibody
상품 한눈에 보기
사람 ADAM33 단백질을 인식하는 토끼 폴리클로날 항체로, ADAM metallopeptidase domain 33 연구에 적합합니다. PrEST 항원을 이용해 친화 정제되었으며, IHC 등 다양한 응용에 사용 가능합니다. 40% 글리세롤, PBS 완충액에 보존됩니다.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-ADAM33 Antibody
Target: ADAM metallopeptidase domain 33
Supplier: Atlas Antibodies
Product Description
Polyclonal antibody against human ADAM33 protein.
Affinity purified using the PrEST antigen as affinity ligand.
Alternative Gene Names
C20orf153, dJ964F7.1, DKFZp434K0521
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | ADAM metallopeptidase domain 33 |
| Target Gene | ADAM33 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Epitope Sequence | NSAGDAHGNCGQDSEGHFLPCAGRDALCGKLQCQGGKPSLLAPHMVPVDSTVHLDGQEVTCRGALALPSAQLD |
| Verified Species Reactivity | Human |
| Interspecies Identity | Mouse ENSMUSG00000027318 (64%), Rat ENSRNOG00000021242 (64%) |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative |
| Purification Method | Affinity purified using PrEST antigen as affinity ligand |
Material Safety Data Sheet (Sodium Azide)
Recommended Applications
- Immunohistochemistry (IHC)
- Other applications to be optimized by the user
Notes
- Gently mix before use.
- Optimal concentrations and conditions should be determined by the user.
Additional Resources
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-ADAMTS12 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-ADAMTS13 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-ADAM33 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-ADAM7 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-ADAM32 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.