CacheBy
Atlas Antibodies Anti-ADAM33 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-ADAM33 Antibody

상품 한눈에 보기

사람 ADAM33 단백질을 인식하는 토끼 폴리클로날 항체로, ADAM metallopeptidase domain 33 연구에 적합합니다. PrEST 항원을 이용해 친화 정제되었으며, IHC 등 다양한 응용에 사용 가능합니다. 40% 글리세롤, PBS 완충액에 보존됩니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA067152-100 Anti-ADAM33 Antibody, ADAM metallopeptidase domain 33 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA067152-25 Anti-ADAM33 Antibody, ADAM metallopeptidase domain 33 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-ADAM33 Antibody

Anti-ADAM33 Antibody

Target: ADAM metallopeptidase domain 33
Supplier: Atlas Antibodies


Product Description

Polyclonal antibody against human ADAM33 protein.
Affinity purified using the PrEST antigen as affinity ligand.


Alternative Gene Names

C20orf153, dJ964F7.1, DKFZp434K0521


Target Information

항목 내용
Target Protein ADAM metallopeptidase domain 33
Target Gene ADAM33
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence NSAGDAHGNCGQDSEGHFLPCAGRDALCGKLQCQGGKPSLLAPHMVPVDSTVHLDGQEVTCRGALALPSAQLD
Verified Species Reactivity Human
Interspecies Identity Mouse ENSMUSG00000027318 (64%), Rat ENSRNOG00000021242 (64%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using PrEST antigen as affinity ligand

Material Safety Data Sheet (Sodium Azide)


  • Immunohistochemistry (IHC)
  • Other applications to be optimized by the user

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions should be determined by the user.

Additional Resources

Open Datasheet (PDF)


제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.