
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-ADAM32 Antibody
상품 한눈에 보기
Human ADAM32 단백질에 대한 고품질 폴리클로날 항체. IHC 및 Western blot 분석에 적합하며, RNA-seq 및 재조합 발현 데이터 기반 Orthogonal Validation 완료. Rabbit IgG 형식으로 PrEST 항원 친화 정제.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA044156-100 Anti-ADAM32 Antibody, ADAM metallopeptidase domain 32 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA044156-25 Anti-ADAM32 Antibody, ADAM metallopeptidase domain 32 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-ADAM32 Antibody
Anti-ADAM32 Antibody
ADAM metallopeptidase domain 32
Recommended Applications
IHC (Immunohistochemistry)
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.WB (Western Blot)
Recombinant expression validation in WB using target protein overexpression.
Product Description
Polyclonal Antibody against Human ADAM32
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | ADAM metallopeptidase domain 32 |
| Target Gene | ADAM32 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Verified Species Reactivity | Human |
| Interspecies Identity | Rat ENSRNOG00000025728 (40%), Mouse ENSMUSG00000037437 (37%) |
Antigen Sequence
DYKLPRTVPDPLAVKNGSQCDIGRVCVNRECVESRIIKASAHVCSQQCSGHGVCDSRNKCHCSPGYKPPNCQIRSKGFSIFPEEDMGSIME
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



