
Atlas Antibodies Anti-ACY1 Antibody
상품 한눈에 보기
Human ACY1(aminoacylase 1)을 표적하는 Rabbit Polyclonal Antibody. IHC 및 WB 응용에 적합. PrEST 항원으로 친화 정제됨. 높은 종간 서열 유사성(91% Rat, 87% Mouse). 안정적 PBS/glycerol buffer 포맷.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-ACY1 Antibody
Target Information
- Target Protein: aminoacylase 1
- Target Gene: ACY1
- Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
QGMELFVQRPEFHALRAGFALDEGIANPTDAFTVFYSERSPWWVRVTSTGRPGHASRFMEDTAAEKLHKVVNSILAFRE
Verified Species Reactivity
- Human
Interspecies Information
Highest antigen sequence identity to the following orthologs:
- Rat ENSRNOG00000011189 (91%)
- Mouse ENSMUSG00000023262 (87%)
Product Description
Polyclonal Antibody against Human ACY1
Recommended Applications
- Immunohistochemistry (IHC)
- Western Blot (WB)
Technical Specifications
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative |
| Purification Method | Affinity purified using PrEST antigen as affinity ligand |
| Storage Notes | Gently mix before use. Optimal concentrations and conditions should be determined by the user. |
Reference Links
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-ACVRL1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-ACVR2B Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-ACY1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-ACVR1C Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-ACVR1B Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.