Atlas Antibodies Anti-ACY1 Antibody

상품 한눈에 보기

Human ACY1(aminoacylase 1)을 표적하는 Rabbit Polyclonal Antibody. IHC 및 WB 응용에 적합. PrEST 항원으로 친화 정제됨. 높은 종간 서열 유사성(91% Rat, 87% Mouse). 안정적 PBS/glycerol buffer 포맷.

브랜드: Atlas Antibodies
카테고리: Polyclonal Antibodies
판매단위: 100ul, 25ul

#Antibodies #Atlas Antibodies

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA036174-100 Anti-ACY1 Antibody, aminoacylase 1 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA036174-25 Anti-ACY1 Antibody, aminoacylase 1 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Atlas Antibodies · Atlas Antibodies Anti-ACY1 Antibody

Anti-ACY1 Antibody

Target Information

Target Protein: aminoacylase 1
Target Gene: ACY1
Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
```
QGMELFVQRPEFHALRAGFALDEGIANPTDAFTVFYSERSPWWVRVTSTGRPGHASRFMEDTAAEKLHKVVNSILAFRE
```

Verified Species Reactivity

Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

Rat ENSRNOG00000011189 (91%)
Mouse ENSMUSG00000023262 (87%)

Product Description

Polyclonal Antibody against Human ACY1

Recommended Applications

Immunohistochemistry (IHC)
Western Blot (WB)

Technical Specifications

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method	Affinity purified using PrEST antigen as affinity ligand
Storage Notes	Gently mix before use. Optimal concentrations and conditions should be determined by the user.