CacheBy
Atlas Antibodies Anti-ACVR1C Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-ACVR1C Antibody

상품 한눈에 보기

Human ACVR1C 단백질을 인식하는 토끼 유래 폴리클로날 항체로, IHC 등 다양한 응용에 적합. PrEST 항원을 이용한 친화 정제 방식으로 높은 특이성과 재현성을 제공. ACVR1C(ALK7) 타겟 연구용으로 권장.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA007982-100 Anti-ACVR1C Antibody, activin A receptor, type IC 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA007982-25 Anti-ACVR1C Antibody, activin A receptor, type IC 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-ACVR1C Antibody

Anti-ACVR1C Antibody

Target: activin A receptor, type IC
Supplier: Atlas Antibodies


Immunohistochemistry (IHC)


Product Description

Polyclonal antibody against human ACVR1C.


Alternative Gene Names

ACVRLK7, ALK7

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein activin A receptor, type IC
Target Gene ACVR1C
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence ELSPGLKCVCLLCDSSNFTCQTEGACWASVMLTNGKEQVIKSCVSLPELNAQVFCHSSNNVTKTECCFTDFCNNITLHL
Verified Species Reactivity Human
Interspecies Identity Rat ENSRNOG00000004828 (96%), Mouse ENSMUSG00000026834 (96%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Material Safety Data Sheet


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.