Atlas Antibodies Anti-ACSBG1 Antibody

상품 한눈에 보기

Human ACSBG1 단백질을 인식하는 토끼 폴리클로날 항체로, WB 및 IHC에 적합합니다. PrEST 항원으로 친화 정제되었으며, 독립 항체 검증을 통해 신뢰성 높은 결과를 제공합니다. 40% 글리세롤/PBS 버퍼에 보존되어 장기 안정성이 우수합니다.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA058869-100 Anti-ACSBG1 Antibody, acyl-CoA synthetase bubblegum family member 1 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA058869-25 Anti-ACSBG1 Antibody, acyl-CoA synthetase bubblegum family member 1 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Target Protein: acyl-CoA synthetase bubblegum family member 1
Supplier: Atlas Antibodies

Polyclonal antibody against human ACSBG1 (acyl-CoA synthetase bubblegum family member 1).

Validation:
Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein.

BG1, BGM, FLJ30320, hBG1, hsBG, KIAA0631, MGC14352

항목	내용
Target Gene	ACSBG1
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence	ANVIMVDTQKQLEKILKIWKQLPHLKAVVIYKEPPPNKMANVYTMEEFMELGNEVPEEALDAIIDTQQPNQCCVLV
Verified Species Reactivity	Human
Interspecies Identity	Mouse (91%), Rat (91%)
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide as preservative
Purification Method	Affinity purified using the PrEST antigen as affinity ligand
Storage Notes	Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Safety Information	Material Safety Data Sheet