Atlas Antibodies Anti-ACSBG1 Antibody

상품 한눈에 보기

Human ACSBG1 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 및 WB에 적합합니다. PrEST 항원을 이용해 친화 정제되었으며, 독립 항체 비교로 검증되었습니다. 40% 글리세롤/PBS 완충액에 보존되어 있습니다.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA041642-100 Anti-ACSBG1 Antibody, acyl-CoA synthetase bubblegum family member 1 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA041642-25 Anti-ACSBG1 Antibody, acyl-CoA synthetase bubblegum family member 1 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Target: acyl-CoA synthetase bubblegum family member 1 (ACSBG1)
Supplier: Atlas Antibodies

Validation:
Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein.

Polyclonal antibody against human ACSBG1.

BG1, BGM, FLJ30320, hBG1, hsBG, KIAA0631, MGC14352

Target Protein: acyl-CoA synthetase bubblegum family member 1
Target Gene: ACSBG1
Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence

ANVIMVDTQKQLEKILKIWKQLPHLKAVVIYKEPPPNKMANVYTMEEFMELGNEVPEEALDAIIDTQQPNQCCVLV

Interspecies Information:
Highest antigen sequence identity to the following orthologs:

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method	Affinity purified using the PrEST antigen as affinity ligand