Atlas Antibodies Anti-ACAN Antibody
상품 한눈에 보기
Human ACAN 단백질을 인식하는 폴리클로날 항체로, IHC 검증을 통해 독립 항체 간 비교로 신뢰성 확보. Rabbit 호스트에서 생산되며, PrEST 항원으로 친화 정제. Human에 반응하며 aggrecan 단백질 연구에 적합.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-ACAN Antibody
Target Protein: aggrecan
Supplier: Atlas Antibodies
Recommended Applications
Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein.
Product Description
Polyclonal Antibody against Human ACAN
Alternative Gene Names
AGC1, CSPG1, CSPGCP, MSK16
Specifications
| 항목 | 내용 |
|---|---|
| Target Protein | aggrecan |
| Target Gene | ACAN |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Antigen Sequence (AA) | LPLPRNITEGEARGSVILTVKPIFEVSPSPLEPEEPFTFAPEIGATAFAEVENETGEATRPWGFPTPG |
| Verified Species Reactivity | Human |
| Interspecies Information | Mouse ENSMUSG00000030607 (69%), Rat ENSRNOG00000028992 (63%) |
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
| Notes | Gently mix before use. Optimal concentrations and conditions should be determined by the user. |
| Safety Data | Material Safety Data Sheet |
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.