Atlas Antibodies Anti-ACAN Antibody

상품 한눈에 보기

Human ACAN 단백질을 인식하는 폴리클로날 항체로, IHC 검증을 통해 독립 항체 간 비교로 신뢰성 확보. Rabbit 호스트에서 생산되며, PrEST 항원으로 친화 정제. Human에 반응하며 aggrecan 단백질 연구에 적합.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA038242-100 Anti-ACAN Antibody, aggrecan 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA038242-25 Anti-ACAN Antibody, aggrecan 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Target Protein: aggrecan
Supplier: Atlas Antibodies

Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein.

Polyclonal Antibody against Human ACAN

AGC1, CSPG1, CSPGCP, MSK16

항목	내용
Target Protein	aggrecan
Target Gene	ACAN
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Antigen Sequence (AA)	LPLPRNITEGEARGSVILTVKPIFEVSPSPLEPEEPFTFAPEIGATAFAEVENETGEATRPWGFPTPG
Verified Species Reactivity	Human
Interspecies Information	Mouse ENSMUSG00000030607 (69%), Rat ENSRNOG00000028992 (63%)
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method	Affinity purified using the PrEST antigen as affinity ligand
Notes	Gently mix before use. Optimal concentrations and conditions should be determined by the user.
Safety Data	Material Safety Data Sheet