Atlas Antibodies Anti-ACAN Antibody

상품 한눈에 보기

Human ACAN 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 등 단백질 발현 검증에 적합. PrEST 항원을 이용해 친화 정제되었으며, 높은 특이성과 재현성을 제공. AGC1, CSPG1 등 다양한 유전자명으로도 알려진 aggrecan 단백질 검출에 활용 가능.

카탈로그번호: HPA038241-xxx (2개 옵션)
브랜드: Atlas Antibodies
카테고리: Polyclonal Antibodies
판매단위: 100ul, 25ul

#Antibodies #Atlas Antibodies

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA038241-100 Anti-ACAN Antibody, aggrecan 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA038241-25 Anti-ACAN Antibody, aggrecan 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Atlas Antibodies · Atlas Antibodies Anti-ACAN Antibody

Anti-ACAN Antibody

Target Protein: aggrecan
Supplier: Atlas Antibodies

Recommended Applications

Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein.

Product Description

Polyclonal antibody against human ACAN (aggrecan).

Alternative Gene Names

AGC1, CSPG1, CSPGCP, MSK16

Open Datasheet (PDF)

Specifications

항목	내용
Target Protein	aggrecan
Target Gene	ACAN
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence	LPLPRNITEGEARGSVILTVKPIFEVSPSPLEPEEPFTFAPEIGATAFAEVENETGEATRPWGFPTPG
Verified Species Reactivity	Human
Interspecies Identity	Mouse: 69% (ENSMUSG00000030607), Rat: 63% (ENSRNOG00000028992)
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method	Affinity purified using PrEST antigen as affinity ligand
Notes	Gently mix before use. Optimal concentrations and conditions should be determined by the user.
MSDS	Material Safety Data Sheet