CacheBy
Atlas Antibodies Anti-ABR Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-ABR Antibody

상품 한눈에 보기

Human ABR 단백질에 대한 Rabbit Polyclonal 항체로, PrEST 항원으로 친화 정제됨. ICC 등 다양한 응용에 적합하며, 인체 반응성 검증 완료. 40% glycerol 및 PBS 완충액 사용, sodium azide 보존제 포함.

카탈로그번호
HPA053618-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA053618-100 Anti-ABR Antibody, active BCR-related 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA053618-25 Anti-ABR Antibody, active BCR-related 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-ABR Antibody

Anti-ABR Antibody

Target: active BCR-related
Type: Polyclonal Antibody against Human ABR


  • ICC (Immunocytochemistry)

Product Description

Polyclonal antibody targeting the human ABR protein.


Alternative Gene Names

  • MDB

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein active BCR-related
Target Gene ABR
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Information Mouse ENSMUSG00000017631 (91%), Rat ENSRNOG00000056837 (86%)

Antigen Sequence:
LYSNFSYGTDEYDGEGNEEQKGPPEGSETMPYIDESPTMSPQLSARSQGGGDGVSPTPPEGLAPGVEAGK


Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Material Safety Data Sheet (MSDS)


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.