CacheBy
Atlas Antibodies Anti-ABT1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-ABT1 Antibody

상품 한눈에 보기

인간 ABT1 단백질을 인식하는 폴리클로날 항체입니다. 토끼에서 생산되었으며, PrEST 항원을 이용해 친화 정제되었습니다. 면역형광(ICC) 등 다양한 응용에 적합하며, 높은 종 간 반응 특이성을 보입니다. 글리세롤 기반 완충액에 보존되어 있습니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA077039-100 Anti-ABT1 Antibody, activator of basal transcription 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA077039-25 Anti-ABT1 Antibody, activator of basal transcription 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-ABT1 Antibody

Anti-ABT1 Antibody

Target: activator of basal transcription 1 (ABT1)

  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against human ABT1.

Open Datasheet

Target Information

항목 내용
Target Protein activator of basal transcription 1
Target Gene ABT1
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence SKKRVVPGIVYLGHIPPRFRPLHVRNLLSAYGEVGRVFFQAEDRFVRRKKKAAAAAGGKKRSYTKDYTEGWVEFR
Verified Species Reactivity Human
Interspecies Homology Rat ENSRNOG00000017585 (89%), Mouse ENSMUSG00000036376 (88%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Information

항목 내용
Buffer Composition 40% glycerol and PBS (pH 7.2)
Preservative 0.02% sodium azide
MSDS Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Recommended Application - ICC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.