Atlas Antibodies Anti-AATK Antibody

상품 한눈에 보기

Human AATK 단백질을 인식하는 폴리클로날 항체로, Rabbit에서 생성됨. IHC를 통한 Orthogonal 검증 수행. Affinity purification으로 높은 특이성과 재현성 확보. Apoptosis 관련 신호 연구에 적합.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA009073-100 Anti-AATK Antibody, apoptosis-associated tyrosine kinase 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA009073-25 Anti-AATK Antibody, apoptosis-associated tyrosine kinase 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Polyclonal Antibody against Human AATK

Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence:
TSGIFTDTSSDGLQARRPDVVPAFRSLQKQVGTPDSLDSLDIPSSASDGGYEVFSPSATGPSGGQPRALDSGYDTENYESPEFVLKEAQEGCEPQAFAELASEGEGPGPETRLSTSLSGLNEKNPYRDSA

Human

Species	Ortholog ID	Sequence Identity
Rat	ENSRNOG00000004392	76%
Mouse	ENSMUSG00000025375	76%

Property	Description
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide added as preservative
Purification Method	Affinity purified using the PrEST antigen as affinity ligand