CacheBy
Atlas Antibodies Anti-AASS Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-AASS Antibody

상품 한눈에 보기

Human AASS 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 및 WB에서 독립적 검증을 거친 고품질 시약입니다. PrEST 항원을 사용해 친화정제되었으며, 인간에 특이적 반응성을 보입니다. LKRSDH/LORSDH 유전자 연구에 적합합니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA020728-100 Anti-AASS Antibody, aminoadipate-semialdehyde synthase 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA020728-25 Anti-AASS Antibody, aminoadipate-semialdehyde synthase 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-AASS Antibody

Anti-AASS Antibody

Target: aminoadipate-semialdehyde synthase
Type: Polyclonal Antibody against Human AASS


  • IHC Orthogonal Validation:
    Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

  • WB Independent Validation:
    Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein.

  • ICC Application Supported


Product Description

Polyclonal antibody raised in rabbit against human aminoadipate-semialdehyde synthase (AASS).

Alternative Gene Names: LKRSDH, LORSDH
Target Protein: aminoadipate-semialdehyde synthase
Target Gene: AASS
Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence

AEWLGLLGDEQVPQAESILDALSKHLVMKLSYGPEEKDMIVMRDSFGIRHPSGHLEHKTIDLVAYGDINGFSAMAKTVGLPTAMAAKMLLDGEIGAKGLMGPFSKEIYGPILERIKA

Verified Species Reactivity

Human

Interspecies Information

Species Gene ID Sequence Identity
Mouse ENSMUSG00000029695 93%
Rat ENSRNOG00000039494 93%

Specifications

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Storage Gently mix before use. Optimal concentrations and conditions should be determined by the user.

Material Safety Data Sheet


제품 이미지

Enhanced Validation
IHC Orthogonal
WB Independent
ICC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.