Thermo Fisher Scientific ITK Polyclonal Antibody
Rabbit 폴리클로날 항체로, 인간 ITK 단백질의 C-말단 서열을 인식합니다. Western blot에 최적화되어 있으며, 재구성 시 500 µg/mL 농도로 사용 가능합니다. T세포 증식 및 분화 연구에 적합합니다. 연구용으로만 사용됩니다.
- 판매단위
- pk
카탈로그
1개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다Thermo Fisher Scientific · Thermo Fisher Scientific ITK Polyclonal Antibody
Applications
- Western Blot (WB): 0.1–0.5 µg/mL
Product Specifications
| 항목 | 내용 |
|---|---|
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | A synthetic peptide corresponding to a sequence at the C-terminus of human ITK |
| Conjugate | Unconjugated |
| Form | Lyophilized |
| Concentration | 500 µg/mL |
| Storage Conditions | -20°C |
| Shipping Conditions | Wet ice |
| RRID | AB_2746657 |
Product Specific Information
- Synthetic peptide sequence: 575–617aa, FRLYKPRLASTHVYQIMNHCWKERPEDRPAFSRLLRQLAEIAE
- Add 0.2 mL of distilled water to reconstitute, yielding a final concentration of 500 µg/mL
Target Information
ITK (IL2-inducible T-cell kinase) is a tyrosine kinase expressed in T-cells, containing both SH2 and SH3 domains. It is involved in T-cell proliferation and differentiation.
The Tec family of non-receptor tyrosine kinases includes six proteins: Tec, Itk (also known as Emt or Tsk), Btk, Bmx, Txk (also known as Rlk), and Dsrc28C.
All members contain SH3 and SH2 domains, and except for Txk and Dsrc28C, also possess pleckstrin homology (PH) and Tec homology (TH) domains at their N-termini.
Itk associates with CD28 and becomes activated following CD28 ligation.
For Research Use Only.
Not for use in diagnostic procedures.
Not for resale without express authorization.
Thermo Fisher Scientific 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.