Thermo Fisher Scientific ITK Polyclonal Antibody

Applications

• Western Blot (WB): 0.1–0.5 µg/mL

Product Specifications

Product Specific Information

• Synthetic peptide sequence: 575–617aa, FRLYKPRLASTHVYQIMNHCWKERPEDRPAFSRLLRQLAEIAE
• Add 0.2 mL of distilled water to reconstitute, yielding a final concentration of 500 µg/mL

Target Information

ITK (IL2-inducible T-cell kinase) is a tyrosine kinase expressed in T-cells, containing both SH2 and SH3 domains. It is involved in T-cell proliferation and differentiation.
The Tec family of non-receptor tyrosine kinases includes six proteins: Tec, Itk (also known as Emt or Tsk), Btk, Bmx, Txk (also known as Rlk), and Dsrc28C.
All members contain SH3 and SH2 domains, and except for Txk and Dsrc28C, also possess pleckstrin homology (PH) and Tec homology (TH) domains at their N-termini.
Itk associates with CD28 and becomes activated following CD28 ligation.

For Research Use Only.
Not for use in diagnostic procedures.
Not for resale without express authorization.