Thermo Fisher Scientific RASGRF1 Polyclonal Antibody
Thermo Fisher Scientific의 RASGRF1 Polyclonal Antibody는 마우스 시료에 반응하는 토끼 유래 다클론 항체로, Western blot 및 ELISA에 적합합니다. RASGRF1 단백질의 1-190 아미노산 서열 기반 항원으로 제작되었으며, 고순도 Affinity Chromatography 정제 및 안정한 PBS/glycerol 포뮬러로 제공됩니다.
- 카탈로그번호
- PA593320
- 판매단위
- pk
카탈로그
1개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다Thermo Fisher Scientific · Thermo Fisher Scientific RASGRF1 Polyclonal Antibody
Applications and Tested Dilution
| Application | Tested Dilution |
|---|---|
| Western Blot (WB) | 1:500–1:2,000 |
| ELISA | 1 µg/mL |
Product Specifications
| 항목 | 내용 |
|---|---|
| Species Reactivity | Mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1–190 of human RASGRF1 (NP_001139120.1) |
| Conjugate | Unconjugated |
| Form | Liquid |
| Concentration | 2.39 mg/mL |
| Purification | Affinity Chromatography |
| Storage Buffer | PBS, pH 7.3, with 50% glycerol |
| Contains | 0.02% sodium azide |
| Storage Conditions | -20°C, Avoid Freeze/Thaw Cycles |
| Shipping Conditions | Wet ice |
| RRID | AB_2806715 |
Product Specific Information
Immunogen sequence:
MQKGIRLNDGHVASLGLLARKDGTRKGYL SKRSSDNTKWQTKWFALLQNLLFYFESDSSSRPSGLYLLEGCVCDRAPSPK PALSAKEPLEKQHYFTVNFSHENQKALELRTEDAKDCDEWVAAIAHASYRTLATEHEALMQKYLHLLQIVETEKTVAKQLRQQIEDGEIEIERLKAEIT SLLKDNERIQS
Positive Samples: Mouse brain
Target Information
RASGRF1 is a guanine nucleotide exchange factor (GEF) similar to the Saccharomyces cerevisiae CDC25 gene product. It stimulates the dissociation of GDP from RAS protein. Mouse studies suggest that the Ras-GEF activity of this protein in the brain can be activated by Ca²⁺ influx, muscarinic receptors, and G protein βγ subunits. This pathway may play an important role in long-term memory.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
Thermo Fisher Scientific 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.