Thermo Fisher Scientific RASGRF1 Polyclonal Antibody
Thermo Fisher Scientific의 RASGRF1 Polyclonal Antibody는 마우스 시료에 반응하는 토끼 유래 다클론 항체로, Western blot 및 ELISA에 적합합니다. RASGRF1 단백질의 1-190 아미노산 서열 기반 항원으로 제작되었으며, 고순도 Affinity Chromatography 정제 및 안정한 PBS/glycerol 포뮬러로 제공됩니다.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Applications and Tested Dilution
| Application | Tested Dilution |
|---|---|
| Western Blot (WB) | 1:500–1:2,000 |
| ELISA | 1 µg/mL |
Product Specifications
| 항목 | 내용 |
|---|---|
| Species Reactivity | Mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1–190 of human RASGRF1 (NP_001139120.1) |
| Conjugate | Unconjugated |
| Form | Liquid |
| Concentration | 2.39 mg/mL |
| Purification | Affinity Chromatography |
| Storage Buffer | PBS, pH 7.3, with 50% glycerol |
| Contains | 0.02% sodium azide |
| Storage Conditions | -20°C, Avoid Freeze/Thaw Cycles |
| Shipping Conditions | Wet ice |
| RRID | AB_2806715 |
Product Specific Information
Immunogen sequence:
MQKGIRLNDGHVASLGLLARKDGTRKGYL SKRSSDNTKWQTKWFALLQNLLFYFESDSSSRPSGLYLLEGCVCDRAPSPK PALSAKEPLEKQHYFTVNFSHENQKALELRTEDAKDCDEWVAAIAHASYRTLATEHEALMQKYLHLLQIVETEKTVAKQLRQQIEDGEIEIERLKAEIT SLLKDNERIQS
Positive Samples: Mouse brain
Target Information
RASGRF1 is a guanine nucleotide exchange factor (GEF) similar to the Saccharomyces cerevisiae CDC25 gene product. It stimulates the dissociation of GDP from RAS protein. Mouse studies suggest that the Ras-GEF activity of this protein in the brain can be activated by Ca²⁺ influx, muscarinic receptors, and G protein βγ subunits. This pathway may play an important role in long-term memory.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
🏷️Thermo Fisher Scientific 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요
Thermo Fisher Scientific
Thermo Fisher Scientific RPS5 Polyclonal Antibody
618,800원
Thermo Fisher Scientific
Thermo Fisher Scientific RPL3 Polyclonal Antibody
618,800원
Thermo Fisher Scientific
Thermo Fisher Scientific RASGRF1 Polyclonal Antibody
618,800원
Thermo Fisher Scientific
Thermo Fisher Scientific Relaxin 2 Polyclonal Antibody
618,800원
Thermo Fisher Scientific
Thermo Fisher Scientific QARS Polyclonal Antibody
618,800원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|