Thermo Fisher Scientific NTCP Polyclonal Antibody
NTCP 단백질을 인식하는 Rabbit Polyclonal Antibody로 Western blot, IHC, Flow Cytometry에 사용 가능. Mouse 및 Rat 반응성. 항원 친화 크로마토그래피로 정제되었으며, 동결건조 형태로 제공. 연구용으로만 사용 가능.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Applications and Tested Dilutions
| Application | Tested Dilution | Publications |
|---|---|---|
| Western Blot (WB) | 0.1–0.5 µg/mL | View 1 publication |
| Immunohistochemistry (IHC) | 0.5–1 µg/mL | View 2 publications |
| Immunohistochemistry (Paraffin) (IHC (P)) | 0.5–1 µg/mL | - |
| Immunohistochemistry (Frozen) (IHC (F)) | 0.5–1 µg/mL | - |
| Flow Cytometry (Flow) | 1–3 µg/1×10⁶ cells | View 1 publication |
Product Specifications
| Specification | Description |
|---|---|
| Species Reactivity | Mouse, Rat |
| Published Species | Human, Mouse, Rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | A synthetic peptide corresponding to a sequence at the C-terminus of mouse SLC10A1 (296–336aa: EGLLFIIIFRCYLKIKPQKDQTKITYKAAATEDATPAALEK) |
| Conjugate | Unconjugated |
| Form | Lyophilized |
| Concentration | 500 µg/mL |
| Purification | Antigen affinity chromatography |
| Storage Buffer | PBS with 4 mg trehalose |
| Contains | No preservative |
| Storage Conditions | -20°C |
| Shipping Conditions | Ambient (domestic); Wet ice (international) |
| RRID | AB_2747116 |
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Target Information
Sodium/bile acid cotransporters are integral membrane glycoproteins that participate in the enterohepatic circulation of bile acids. Two homologous transporters are involved in the reabsorption of bile acids:
- SLC10A2: Absorbs bile acids from the intestinal lumen, bile duct, and kidney (apical localization)
- SLC10A1: Found in the basolateral membranes of hepatocytes
Usage Notice
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
🏷️Thermo Fisher Scientific 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요
Thermo Fisher Scientific
Thermo Fisher Scientific SHC Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific SHBG Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific NTCP Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific SIDT1 Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific SIRT7 Polyclonal Antibody
568,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|