CacheBy
Thermo Fisher Scientific NTCP Polyclonal Antibody
원본

Thermo Fisher Scientific NTCP Polyclonal Antibody

상품 한눈에 보기

NTCP 단백질을 인식하는 Rabbit Polyclonal Antibody로 Western blot, IHC, Flow Cytometry에 사용 가능. Mouse 및 Rat 반응성. 항원 친화 크로마토그래피로 정제되었으며, 동결건조 형태로 제공. 연구용으로만 사용 가능.

카탈로그번호
PA580001
판매단위
pk
카탈로그 보기

카탈로그

1개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
마지막 업데이트 2025. 08. 01. 오후 06:41
Thermo Fisher Scientific PA580001 NTCP Polyclonal Antibody 100 ug pk판매 단위 pk ·
재고 확인 필요
568,000원VAT 포함 624,800원

Thermo Fisher Scientific · Thermo Fisher Scientific NTCP Polyclonal Antibody

Applications and Tested Dilutions

Application Tested Dilution Publications
Western Blot (WB) 0.1–0.5 µg/mL View 1 publication
Immunohistochemistry (IHC) 0.5–1 µg/mL View 2 publications
Immunohistochemistry (Paraffin) (IHC (P)) 0.5–1 µg/mL -
Immunohistochemistry (Frozen) (IHC (F)) 0.5–1 µg/mL -
Flow Cytometry (Flow) 1–3 µg/1×10⁶ cells View 1 publication

Product Specifications

Specification Description
Species Reactivity Mouse, Rat
Published Species Human, Mouse, Rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen A synthetic peptide corresponding to a sequence at the C-terminus of mouse SLC10A1 (296–336aa: EGLLFIIIFRCYLKIKPQKDQTKITYKAAATEDATPAALEK)
Conjugate Unconjugated
Form Lyophilized
Concentration 500 µg/mL
Purification Antigen affinity chromatography
Storage Buffer PBS with 4 mg trehalose
Contains No preservative
Storage Conditions -20°C
Shipping Conditions Ambient (domestic); Wet ice (international)
RRID AB_2747116

Product Specific Information

Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.

Target Information

Sodium/bile acid cotransporters are integral membrane glycoproteins that participate in the enterohepatic circulation of bile acids. Two homologous transporters are involved in the reabsorption of bile acids:

  • SLC10A2: Absorbs bile acids from the intestinal lumen, bile duct, and kidney (apical localization)
  • SLC10A1: Found in the basolateral membranes of hepatocytes

Usage Notice

For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.

Thermo Fisher Scientific 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.