원본
Thermo Fisher Scientific NTCP Polyclonal Antibody
상품 한눈에 보기
NTCP 단백질을 인식하는 Rabbit Polyclonal Antibody로 Western blot, IHC, Flow Cytometry에 사용 가능. Mouse 및 Rat 반응성. 항원 친화 크로마토그래피로 정제되었으며, 동결건조 형태로 제공. 연구용으로만 사용 가능.
- 카탈로그번호
- PA580001
- 판매단위
- pk
카탈로그
1개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
마지막 업데이트 2025. 08. 01. 오후 06:41
카탈로그 번호 · 상품 설명출고판매가담기
Thermo Fisher Scientific PA580001 NTCP Polyclonal Antibody 100 ug pk판매 단위 pk ·
재고 확인 필요
568,000원VAT 포함 624,800원
Thermo Fisher Scientific · Thermo Fisher Scientific NTCP Polyclonal Antibody
Applications and Tested Dilutions
| Application | Tested Dilution | Publications |
|---|---|---|
| Western Blot (WB) | 0.1–0.5 µg/mL | View 1 publication |
| Immunohistochemistry (IHC) | 0.5–1 µg/mL | View 2 publications |
| Immunohistochemistry (Paraffin) (IHC (P)) | 0.5–1 µg/mL | - |
| Immunohistochemistry (Frozen) (IHC (F)) | 0.5–1 µg/mL | - |
| Flow Cytometry (Flow) | 1–3 µg/1×10⁶ cells | View 1 publication |
Product Specifications
| Specification | Description |
|---|---|
| Species Reactivity | Mouse, Rat |
| Published Species | Human, Mouse, Rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | A synthetic peptide corresponding to a sequence at the C-terminus of mouse SLC10A1 (296–336aa: EGLLFIIIFRCYLKIKPQKDQTKITYKAAATEDATPAALEK) |
| Conjugate | Unconjugated |
| Form | Lyophilized |
| Concentration | 500 µg/mL |
| Purification | Antigen affinity chromatography |
| Storage Buffer | PBS with 4 mg trehalose |
| Contains | No preservative |
| Storage Conditions | -20°C |
| Shipping Conditions | Ambient (domestic); Wet ice (international) |
| RRID | AB_2747116 |
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Target Information
Sodium/bile acid cotransporters are integral membrane glycoproteins that participate in the enterohepatic circulation of bile acids. Two homologous transporters are involved in the reabsorption of bile acids:
- SLC10A2: Absorbs bile acids from the intestinal lumen, bile duct, and kidney (apical localization)
- SLC10A1: Found in the basolateral membranes of hepatocytes
Usage Notice
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
Thermo Fisher Scientific 상품 둘러보기
전체보기
Thermo Fisher ScientificThermo Fisher Scientific SHC Polyclonal Antibody568,000원VAT별도
Thermo Fisher ScientificThermo Fisher Scientific SHBG Polyclonal Antibody568,000원VAT별도
Thermo Fisher ScientificThermo Fisher Scientific SIDT1 Polyclonal Antibody568,000원VAT별도
Thermo Fisher ScientificThermo Fisher Scientific SIRT7 Polyclonal Antibody568,000원VAT별도
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.