원본
Thermo Fisher Scientific RPS6KB2 Polyclonal Antibody
상품 한눈에 보기
RPS6KB2 단백질을 인식하는 Thermo Fisher Scientific의 Rabbit Polyclonal Antibody. Western blot 및 IHC(Paraffin) 적용 가능. Human, Mouse, Rat에 반응하며, 고순도 항원 친화 크로마토그래피로 정제됨. 연구용으로 단백질 합성과 세포 증식 연구에 적합.
- 판매단위
- pk
카탈로그
1개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
마지막 업데이트 2025. 07. 29. 오전 11:14
카탈로그 번호 · 상품 설명출고판매가담기
Thermo Fisher Scientific PA582389 RPS6KB2 Polyclonal Antibody 100 ul pk판매 단위 pk ·
재고 확인 필요
740,000원VAT 포함 814,000원
Thermo Fisher Scientific · Thermo Fisher Scientific RPS6KB2 Polyclonal Antibody
Applications
Western Blot (WB)
- Tested Dilution: 0.04–0.4 µg/mL
- Publications: [Reference not provided]
Immunohistochemistry (Paraffin) (IHC (P))
- Tested Dilution: 1:20–1:50
- Publications: [Reference not provided]
Product Specifications
| 항목 | 내용 |
|---|---|
| Species Reactivity | Human, Mouse, Rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | Recombinant protein corresponding to Human RPS6KB2. Recombinant protein control fragment (Product #RP-88709). |
| Conjugate | Unconjugated |
| Form | Liquid |
| Concentration | 0.1 mg/mL |
| Purification | Antigen affinity chromatography |
| Storage buffer | PBS, pH 7.2, with 40% glycerol |
| Contains | 0.02% sodium azide |
| Storage conditions | Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles. |
| Shipping conditions | Wet ice |
| RRID | AB_2789548 |
Product Specific Information
Immunogen sequence:
VDSPDDTALSESANQAFLGFTYVAPSVLDSIKEGFSFQPKLRSPRRLNSSPRAPVSPLKFSPFEGFRPSPSLPEPTELPLPPLLPPPPPSTTAPLPIRPPSGTKK
Target Information
RPS6KB2 (p70S6K beta)는 두 개의 비동일한 카이네스 촉매 도메인을 가진 세린/트레오닌 카이네스로, S6 ribosomal protein 및 eukaryotic translation initiation factor 4B (eIF4B)를 인산화합니다. S6의 인산화는 단백질 합성과 세포 증식을 증가시킵니다.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
제품 이미지
(이미지 없음, OCR 텍스트만 통합됨)
Thermo Fisher Scientific 상품 둘러보기
전체보기
Thermo Fisher ScientificThermo Fisher Scientific Chitotriosidase Polyclonal Antibody740,000원VAT별도
Thermo Fisher ScientificThermo Fisher Scientific CD63 Polyclonal Antibody740,000원VAT별도
Thermo Fisher ScientificThermo Fisher Scientific HSPA4 Polyclonal Antibody740,000원VAT별도
Thermo Fisher ScientificThermo Fisher Scientific PIP5K1B Polyclonal Antibody740,000원VAT별도
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.