CacheBy
Thermo Fisher Scientific RPS6KB2 Polyclonal Antibody
원본

Thermo Fisher Scientific RPS6KB2 Polyclonal Antibody

상품 한눈에 보기

RPS6KB2 단백질을 인식하는 Thermo Fisher Scientific의 Rabbit Polyclonal Antibody. Western blot 및 IHC(Paraffin) 적용 가능. Human, Mouse, Rat에 반응하며, 고순도 항원 친화 크로마토그래피로 정제됨. 연구용으로 단백질 합성과 세포 증식 연구에 적합.

판매단위
pk
카탈로그 보기

카탈로그

1개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
마지막 업데이트 2025. 07. 29. 오전 11:14
Thermo Fisher Scientific PA582389 RPS6KB2 Polyclonal Antibody 100 ul pk판매 단위 pk ·
재고 확인 필요
740,000원VAT 포함 814,000원

Thermo Fisher Scientific · Thermo Fisher Scientific RPS6KB2 Polyclonal Antibody

Applications

Western Blot (WB)

  • Tested Dilution: 0.04–0.4 µg/mL
  • Publications: [Reference not provided]

Immunohistochemistry (Paraffin) (IHC (P))

  • Tested Dilution: 1:20–1:50
  • Publications: [Reference not provided]

Product Specifications

항목 내용
Species Reactivity Human, Mouse, Rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen Recombinant protein corresponding to Human RPS6KB2. Recombinant protein control fragment (Product #RP-88709).
Conjugate Unconjugated
Form Liquid
Concentration 0.1 mg/mL
Purification Antigen affinity chromatography
Storage buffer PBS, pH 7.2, with 40% glycerol
Contains 0.02% sodium azide
Storage conditions Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles.
Shipping conditions Wet ice
RRID AB_2789548

Product Specific Information

Immunogen sequence:
VDSPDDTALSESANQAFLGFTYVAPSVLDSIKEGFSFQPKLRSPRRLNSSPRAPVSPLKFSPFEGFRPSPSLPEPTELPLPPLLPPPPPSTTAPLPIRPPSGTKK


Target Information

RPS6KB2 (p70S6K beta)는 두 개의 비동일한 카이네스 촉매 도메인을 가진 세린/트레오닌 카이네스로, S6 ribosomal protein 및 eukaryotic translation initiation factor 4B (eIF4B)를 인산화합니다. S6의 인산화는 단백질 합성과 세포 증식을 증가시킵니다.


For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.


제품 이미지

(이미지 없음, OCR 텍스트만 통합됨)

Thermo Fisher Scientific 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.