Thermo Fisher Scientific RPS6KB2 Polyclonal Antibody
RPS6KB2 단백질을 인식하는 Thermo Fisher Scientific의 Rabbit Polyclonal Antibody. Western blot 및 IHC(Paraffin) 적용 가능. Human, Mouse, Rat에 반응하며, 고순도 항원 친화 크로마토그래피로 정제됨. 연구용으로 단백질 합성과 세포 증식 연구에 적합.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Applications
Western Blot (WB)
- Tested Dilution: 0.04–0.4 µg/mL
- Publications: [Reference not provided]
Immunohistochemistry (Paraffin) (IHC (P))
- Tested Dilution: 1:20–1:50
- Publications: [Reference not provided]
Product Specifications
| 항목 | 내용 |
|---|---|
| Species Reactivity | Human, Mouse, Rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | Recombinant protein corresponding to Human RPS6KB2. Recombinant protein control fragment (Product #RP-88709). |
| Conjugate | Unconjugated |
| Form | Liquid |
| Concentration | 0.1 mg/mL |
| Purification | Antigen affinity chromatography |
| Storage buffer | PBS, pH 7.2, with 40% glycerol |
| Contains | 0.02% sodium azide |
| Storage conditions | Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles. |
| Shipping conditions | Wet ice |
| RRID | AB_2789548 |
Product Specific Information
Immunogen sequence:
VDSPDDTALSESANQAFLGFTYVAPSVLDSIKEGFSFQPKLRSPRRLNSSPRAPVSPLKFSPFEGFRPSPSLPEPTELPLPPLLPPPPPSTTAPLPIRPPSGTKK
Target Information
RPS6KB2 (p70S6K beta)는 두 개의 비동일한 카이네스 촉매 도메인을 가진 세린/트레오닌 카이네스로, S6 ribosomal protein 및 eukaryotic translation initiation factor 4B (eIF4B)를 인산화합니다. S6의 인산화는 단백질 합성과 세포 증식을 증가시킵니다.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
제품 이미지
(이미지 없음, OCR 텍스트만 통합됨)
🏷️Thermo Fisher Scientific 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요
Thermo Fisher Scientific
Thermo Fisher Scientific Chitotriosidase Polyclonal Antibody
740,000원
Thermo Fisher Scientific
Thermo Fisher Scientific CD63 Polyclonal Antibody
740,000원
Thermo Fisher Scientific
Thermo Fisher Scientific RPS6KB2 Polyclonal Antibody
740,000원
Thermo Fisher Scientific
Thermo Fisher Scientific HSPA4 Polyclonal Antibody
740,000원
Thermo Fisher Scientific
Thermo Fisher Scientific PIP5K1B Polyclonal Antibody
740,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|