CacheBy
Thermo Fisher Scientific ARHGEF1 Polyclonal Antibody
원본

Thermo Fisher Scientific ARHGEF1 Polyclonal Antibody

상품 한눈에 보기

ARHGEF1 단백질을 인식하는 Thermo Fisher Scientific의 토끼 폴리클로날 항체로, Western blot, IHC, ICC/IF, Flow Cytometry 등 다양한 응용에 적합합니다. 인간, 마우스, 랫트 반응성이 있으며, 항원 친화 크로마토그래피로 정제되었습니다.

판매단위
pk
카탈로그 보기

카탈로그

1개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
마지막 업데이트 2025. 08. 05. 오후 06:14
Thermo Fisher Scientific PA578821 ARHGEF1 Polyclonal Antibody 100 ug pk판매 단위 pk ·
재고 확인 필요
568,000원VAT 포함 624,800원

Thermo Fisher Scientific · Thermo Fisher Scientific ARHGEF1 Polyclonal Antibody

Applications and Tested Dilutions

Application Tested Dilution
Western Blot (WB) 0.1–0.5 µg/mL
Immunohistochemistry (Paraffin) (IHC (P)) 0.5–1 µg/mL
Immunocytochemistry (ICC/IF) 2 µg/mL
Flow Cytometry (Flow) 1–3 µg/1×10⁶ cells

Product Specifications

Specification Detail
Species Reactivity Human, Mouse, Rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen A synthetic peptide corresponding to a sequence at the N-terminus of human ARHGEF1 (41–71aa: EQNSQFQSLEQVKRRPAHLMALLQHVALQFE)
Conjugate Unconjugated
Form Lyophilized
Concentration 500 µg/mL
Purification Antigen affinity chromatography
Storage Buffer PBS with 5 mg BSA
Contains 0.05 mg sodium azide
Storage Conditions -20°C
Shipping Conditions Ambient (domestic); Wet ice (international)
RRID AB_2745937

Product Specific Information

Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.

Target Information

The Ras superfamily of GTPases, including Ras, Rho/Rac, Sar, Rab, ARF, and Ran subfamilies, regulates cell functions such as cytoskeletal rearrangement, nuclear signaling, and growth. These GTPases act as molecular switches toggling between active (GTP-bound) and inactive (GDP-bound) forms, with activation catalyzed by guanine nucleotide exchange factors (GEFs).
Dbl-related proteins, including FGD1, Lsc, RhoGEF p115, Lfc, Lbc, and Brx, share structural homology and GEF activity toward Rho family GTPases. RhoGEF p115 specifically catalyzes GEF activity for Rho but not for Rac, Cdc42, or Ras GTPases.


For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.

Thermo Fisher Scientific 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.