Thermo Fisher Scientific ARHGEF1 Polyclonal Antibody
ARHGEF1 단백질을 인식하는 Thermo Fisher Scientific의 토끼 폴리클로날 항체로, Western blot, IHC, ICC/IF, Flow Cytometry 등 다양한 응용에 적합합니다. 인간, 마우스, 랫트 반응성이 있으며, 항원 친화 크로마토그래피로 정제되었습니다.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Applications and Tested Dilutions
| Application | Tested Dilution |
|---|---|
| Western Blot (WB) | 0.1–0.5 µg/mL |
| Immunohistochemistry (Paraffin) (IHC (P)) | 0.5–1 µg/mL |
| Immunocytochemistry (ICC/IF) | 2 µg/mL |
| Flow Cytometry (Flow) | 1–3 µg/1×10⁶ cells |
Product Specifications
| Specification | Detail |
|---|---|
| Species Reactivity | Human, Mouse, Rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | A synthetic peptide corresponding to a sequence at the N-terminus of human ARHGEF1 (41–71aa: EQNSQFQSLEQVKRRPAHLMALLQHVALQFE) |
| Conjugate | Unconjugated |
| Form | Lyophilized |
| Concentration | 500 µg/mL |
| Purification | Antigen affinity chromatography |
| Storage Buffer | PBS with 5 mg BSA |
| Contains | 0.05 mg sodium azide |
| Storage Conditions | -20°C |
| Shipping Conditions | Ambient (domestic); Wet ice (international) |
| RRID | AB_2745937 |
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Target Information
The Ras superfamily of GTPases, including Ras, Rho/Rac, Sar, Rab, ARF, and Ran subfamilies, regulates cell functions such as cytoskeletal rearrangement, nuclear signaling, and growth. These GTPases act as molecular switches toggling between active (GTP-bound) and inactive (GDP-bound) forms, with activation catalyzed by guanine nucleotide exchange factors (GEFs).
Dbl-related proteins, including FGD1, Lsc, RhoGEF p115, Lfc, Lbc, and Brx, share structural homology and GEF activity toward Rho family GTPases. RhoGEF p115 specifically catalyzes GEF activity for Rho but not for Rac, Cdc42, or Ras GTPases.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
🏷️Thermo Fisher Scientific 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요
Thermo Fisher Scientific
Thermo Fisher Scientific ARSA Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific ASIC3 Polyclonal Antibody
565,000원
Thermo Fisher Scientific
Thermo Fisher Scientific ARHGEF1 Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific Arginase 2 Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific ARFGAP1 Polyclonal Antibody
568,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|