Thermo Fisher Scientific ARHGEF1 Polyclonal Antibody
ARHGEF1 단백질을 인식하는 Thermo Fisher Scientific의 토끼 폴리클로날 항체로, Western blot, IHC, ICC/IF, Flow Cytometry 등 다양한 응용에 적합합니다. 인간, 마우스, 랫트 반응성이 있으며, 항원 친화 크로마토그래피로 정제되었습니다.
- 판매단위
- pk
카탈로그
1개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다Thermo Fisher Scientific · Thermo Fisher Scientific ARHGEF1 Polyclonal Antibody
Applications and Tested Dilutions
| Application | Tested Dilution |
|---|---|
| Western Blot (WB) | 0.1–0.5 µg/mL |
| Immunohistochemistry (Paraffin) (IHC (P)) | 0.5–1 µg/mL |
| Immunocytochemistry (ICC/IF) | 2 µg/mL |
| Flow Cytometry (Flow) | 1–3 µg/1×10⁶ cells |
Product Specifications
| Specification | Detail |
|---|---|
| Species Reactivity | Human, Mouse, Rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | A synthetic peptide corresponding to a sequence at the N-terminus of human ARHGEF1 (41–71aa: EQNSQFQSLEQVKRRPAHLMALLQHVALQFE) |
| Conjugate | Unconjugated |
| Form | Lyophilized |
| Concentration | 500 µg/mL |
| Purification | Antigen affinity chromatography |
| Storage Buffer | PBS with 5 mg BSA |
| Contains | 0.05 mg sodium azide |
| Storage Conditions | -20°C |
| Shipping Conditions | Ambient (domestic); Wet ice (international) |
| RRID | AB_2745937 |
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Target Information
The Ras superfamily of GTPases, including Ras, Rho/Rac, Sar, Rab, ARF, and Ran subfamilies, regulates cell functions such as cytoskeletal rearrangement, nuclear signaling, and growth. These GTPases act as molecular switches toggling between active (GTP-bound) and inactive (GDP-bound) forms, with activation catalyzed by guanine nucleotide exchange factors (GEFs).
Dbl-related proteins, including FGD1, Lsc, RhoGEF p115, Lfc, Lbc, and Brx, share structural homology and GEF activity toward Rho family GTPases. RhoGEF p115 specifically catalyzes GEF activity for Rho but not for Rac, Cdc42, or Ras GTPases.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
Thermo Fisher Scientific 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.