Atlas Antibodies Anti-LAMP2 Antibody

상품 한눈에 보기

인간 LAMP2 단백질을 표적으로 하는 폴리클로날 항체로, IHC 및 WB 검증을 통해 높은 특이성과 신뢰성을 제공. Rabbit에서 생산된 IgG 항체이며, 프레스트 항원으로 친화 정제됨. 리소좀 관련 단백질 연구에 적합.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA029100-100 Anti-LAMP2 Antibody, lysosomal-associated membrane protein 2 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA029100-25 Anti-LAMP2 Antibody, lysosomal-associated membrane protein 2 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Target: Lysosomal-associated membrane protein 2 (LAMP2)
Supplier: Atlas Antibodies

IHC (Orthogonal validation): Protein expression validated using immunohistochemistry, compared to RNA-seq data of corresponding target in high and low expression tissues.
WB (Recombinant expression validation): Validation in Western blot using recombinant overexpression of the target protein.

Polyclonal Antibody against Human LAMP2

CD107b

항목	내용
Target Protein	Lysosomal-associated membrane protein 2
Target Gene	LAMP2
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity	Human
Interspecies Information	Rat ENSRNOG00000000164 (46%), Mouse ENSMUSG00000016534 (44%)
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method	Affinity purified using the PrEST antigen as affinity ligand

ASTYSIDSVSFSYNTGDNTTFPDAEDKGILTVDELLAIRIPLNDLFRCNSLSTLEKNDVVQHYWDVLV

Gently mix before use.
Optimal concentrations and conditions for each application should be determined by the user.
Material Safety Data Sheet

Enhanced Validation
IHC Orthogonal Validation
WB Recombinant Expression Validation

0개

로그인하시면 이 상품에 대해 문의를 남길 수 있어요.

아직 등록된 문의가 없어요.