
Atlas Antibodies Anti-LAMP2 Antibody
상품 한눈에 보기
인간 LAMP2 단백질을 표적으로 하는 폴리클로날 항체로, IHC 및 WB 검증을 통해 높은 특이성과 신뢰성을 제공. Rabbit에서 생산된 IgG 항체이며, 프레스트 항원으로 친화 정제됨. 리소좀 관련 단백질 연구에 적합.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-LAMP2 Antibody
Target: Lysosomal-associated membrane protein 2 (LAMP2)
Supplier: Atlas Antibodies
Recommended Applications
- IHC (Orthogonal validation): Protein expression validated using immunohistochemistry, compared to RNA-seq data of corresponding target in high and low expression tissues.
- WB (Recombinant expression validation): Validation in Western blot using recombinant overexpression of the target protein.
Product Description
Polyclonal Antibody against Human LAMP2
Alternative Gene Names
CD107b
Specifications
| 항목 | 내용 |
|---|---|
| Target Protein | Lysosomal-associated membrane protein 2 |
| Target Gene | LAMP2 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Verified Species Reactivity | Human |
| Interspecies Information | Rat ENSRNOG00000000164 (46%), Mouse ENSMUSG00000016534 (44%) |
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Antigen Sequence
ASTYSIDSVSFSYNTGDNTTFPDAEDKGILTVDELLAIRIPLNDLFRCNSLSTLEKNDVVQHYWDVLVNotes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
- Material Safety Data Sheet
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-LAMP5 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-LAMP5 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-LAMP2 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-LAMTOR2 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-LAMP2 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.