
Atlas Antibodies Anti-LAMP2 Antibody
상품 한눈에 보기
Human LAMP2 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 및 WB 검증용으로 적합함. Orthogonal 및 recombinant expression 검증 완료. 고순도 Affinity 정제, 안정적인 PBS/glycerol buffer 제공.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-LAMP2 Antibody
lysosomal-associated membrane protein 2
Recommended Applications
IHC Orthogonal Validation
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.WB Recombinant Expression Validation
Recombinant expression validation in WB using target protein overexpression.
Product Description
Polyclonal Antibody against Human LAMP2
Alternative Gene Names
- CD107b
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | lysosomal-associated membrane protein 2 |
| Target Gene | LAMP2 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Sequence | ASTYSIDSVSFSYNTGDNTTFPDAEDKGILTVDELLAIRIPLNDLFRCNSLSTLEKNDVVQHYWDVLV |
| Verified Species Reactivity | Human |
| Interspecies Information | Rat ENSRNOG00000000164 (46%), Mouse ENSMUSG00000016534 (44%) |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-LAMP2 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-LAMTOR2 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-LAMP2 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-LAMP3 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-LAMB3 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.