
Atlas Antibodies Anti-LAD1 Antibody
상품 한눈에 보기
인간 LAD1 단백질을 인식하는 폴리클로날 항체로, IHC, WB(Orthogonal), ICC 등 다양한 응용에 적합. Rabbit 유래 IgG 항체이며 PrEST 항원으로 친화 정제됨. 인간에 대한 반응성이 검증되어 연구용으로 신뢰성 높음.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-LAD1 Antibody
Target Protein: ladinin 1 (LAD1)
Supplier: Atlas Antibodies
Recommended Applications
- Immunohistochemistry (IHC)
- Western Blot (WB, Orthogonal validation)
- Immunocytochemistry (ICC)
Orthogonal validation:
Protein expression verified by WB and compared to RNA-seq data from high and low expression cell lines.
Product Description
Polyclonal antibody against human LAD1.
Antigen Information
- Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST)
- Antigen Sequence:
SPRTISFRMKPKKENSETTLTRSASMKLPDNTVKLGEKLERYHTAIRRSESVKSRGLPCTELFVAPVGVASKRHLFEKELAGQSRAEPASSRKENLRLSGVVTSRLNLWISRTQESGDQDPQEAQKASSATERTQWGQKSDSSL
Species Reactivity
- Verified Species: Human
- Ortholog Identity:
- Rat ENSRNOG00000009144 (75%)
- Mouse ENSMUSG00000041782 (73%)
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative |
| Purification Method | Affinity purified using PrEST antigen |
| Storage | Gently mix before use; determine optimal conditions for each application |
Material Safety Data Sheet: MSDS - Sodium Azide
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-LAG3 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-LAD1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-LAD1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-LACTBL1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-LACTB2 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.