
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-LAD1 Antibody
상품 한눈에 보기
Human LAD1 단백질을 인식하는 토끼 폴리클로날 항체로, IHC, WB, ICC 등 다양한 응용에 적합. Orthogonal validation을 통해 RNA-seq 데이터와 비교 검증됨. PrEST 항원을 이용한 친화 정제 방식으로 고순도 확보. 인체 LAD1 단백질 연구용으로 권장.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA028732-100 Anti-LAD1 Antibody, ladinin 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA028732-25 Anti-LAD1 Antibody, ladinin 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-LAD1 Antibody
Anti-LAD1 Antibody
Target Protein: ladinin 1 (LAD1)
Supplier: Atlas Antibodies
Recommended Applications
- IHC (Immunohistochemistry)
- WB (Western Blot) – Orthogonal validation of protein expression using WB by comparison to RNA-seq data of corresponding target in high and low expression cell lines.
- ICC (Immunocytochemistry)
Product Description
Polyclonal Antibody against Human LAD1
Antigen Information
Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence:
SPRTISFRMKPKKENSETTLTRSASMKLPDNTVKLGEKLERYHTAIRRSESVKSRGLPCTELFVAPVGVASKRHLFEKELAGQSRAEPASSRKENLRLSGVVTSRLNLWISRTQESGDQDPQEAQKASSATERTQWGQKSDSSL
Species Reactivity
| Verified Species | Reactivity |
|---|---|
| Human | Verified |
Interspecies Information
Highest antigen sequence identity to the following orthologs:
| Species | Gene ID | Identity |
|---|---|---|
| Rat | ENSRNOG00000009144 | 75% |
| Mouse | ENSMUSG00000041782 | 73% |
Antibody Properties
| Property | Description |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide as preservative (Material Safety Data Sheet) |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



