
Atlas Antibodies Anti-L1CAM Antibody
인간 L1CAM 단백질을 인식하는 토끼 폴리클로날 항체. IHC 정량 검증 및 RNA-seq 데이터 기반 Orthogonal validation 적용. PrEST 항원으로 친화 정제. 인간 반응성 확인, 마우스 및 랫트와 75% 서열 유사성. PBS/glycerol 완충액에 보존.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-L1CAM Antibody
L1 cell adhesion molecule
Recommended Applications
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
Product Description
Polyclonal Antibody against Human L1CAM
Alternative Gene Names
CD171, HSAS, HSAS1, MASA, MIC5, S10, SPG1
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | L1 cell adhesion molecule |
| Target Gene | L1CAM |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Verified Species Reactivity | Human |
| Interspecies Identity | Rat ENSRNOG00000061230 (75%), Mouse ENSMUSG00000031391 (75%) |
Antigen Sequence
ELRTHNLTDLSPHLRYRFQLQATTKEGPGEAIVREGGTMALSGISDFGNISATAGENYSVVSWVPKEGQCNFRFHILFKALGEEKGGASLSPQYVSYNQSSYTQWDLQPDTDYEIHLFKERMFRHQMAVKTNGTGRVRLPPAGFATE
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative. Material Safety Data Sheet |
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-L2HGDH Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-L1TD1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-L1CAM Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-KYAT1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-KYAT3 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|