
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-L1CAM Antibody
상품 한눈에 보기
인간 L1CAM 단백질을 인식하는 토끼 폴리클로날 항체. IHC 정량 검증 및 RNA-seq 데이터 기반 Orthogonal validation 적용. PrEST 항원으로 친화 정제. 인간 반응성 확인, 마우스 및 랫트와 75% 서열 유사성. PBS/glycerol 완충액에 보존.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA005830-100 Anti-L1CAM Antibody, L1 cell adhesion molecule 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA005830-25 Anti-L1CAM Antibody, L1 cell adhesion molecule 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-L1CAM Antibody
Anti-L1CAM Antibody
L1 cell adhesion molecule
Recommended Applications
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
Product Description
Polyclonal Antibody against Human L1CAM
Alternative Gene Names
CD171, HSAS, HSAS1, MASA, MIC5, S10, SPG1
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | L1 cell adhesion molecule |
| Target Gene | L1CAM |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Verified Species Reactivity | Human |
| Interspecies Identity | Rat ENSRNOG00000061230 (75%), Mouse ENSMUSG00000031391 (75%) |
Antigen Sequence
ELRTHNLTDLSPHLRYRFQLQATTKEGPGEAIVREGGTMALSGISDFGNISATAGENYSVVSWVPKEGQCNFRFHILFKALGEEKGGASLSPQYVSYNQSSYTQWDLQPDTDYEIHLFKERMFRHQMAVKTNGTGRVRLPPAGFATE
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative. Material Safety Data Sheet |
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



