Atlas Antibodies Anti-KYAT3 Antibody

상품 한눈에 보기

인간 KYAT3 단백질을 인식하는 토끼 폴리클로날 항체. IHC 및 WB에서 검증됨. RNA-seq 데이터와 비교한 정교한 발현 검증. 고순도 Affinity 정제 제품으로 신뢰성 높은 단백질 발현 분석에 적합.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA027168-100 Anti-KYAT3 Antibody, kynurenine aminotransferase 3 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA027168-25 Anti-KYAT3 Antibody, kynurenine aminotransferase 3 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Target Protein: kynurenine aminotransferase 3
Supplier: Atlas Antibodies

IHC (Independent validation): Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein.
WB (Orthogonal validation): Orthogonal validation of protein expression using WB by comparison to RNA-seq data of corresponding target in high and low expression cell lines.

Polyclonal Antibody against Human KYAT3

CCBL2, KAT3, KATIII, RBM1, RP11-82K18.3

항목	내용
Target Protein	kynurenine aminotransferase 3
Target Gene	KYAT3
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: VTGWKLGWSIGPNHLIKHLQTVQQNTIYTCATPLQEALAQAFWIDIKRMDDPECYFNSLPKELEVKRDRMVRLLESVG
Verified Species Reactivity	Human
Interspecies Information	Mouse ENSMUSG00000040213 (92%) Rat ENSRNOG00000043426 (82%)
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2). 0.02% sodium azide added as preservative. Material Safety Data Sheet
Purification Method	Affinity purified using the PrEST antigen as affinity ligand
Notes	Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.