
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-KYAT3 Antibody
상품 한눈에 보기
Human KYAT3 단백질을 타깃으로 하는 rabbit polyclonal antibody. IHC와 WB에서 검증됨. PrEST 항원을 이용해 친화 정제됨. Human에 반응하며, Mouse·Rat과 높은 서열 유사성 보유. 40% glycerol/PBS buffer로 안정화됨.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA026538-100 Anti-KYAT3 Antibody, kynurenine aminotransferase 3 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA026538-25 Anti-KYAT3 Antibody, kynurenine aminotransferase 3 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-KYAT3 Antibody
Anti-KYAT3 Antibody
Target: kynurenine aminotransferase 3
Type: Polyclonal Antibody against Human KYAT3
Recommended Applications
- IHC (Independent Antibody Validation): Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein.
- WB (Orthogonal Validation): Orthogonal validation of protein expression using WB by comparison to RNA-seq data of corresponding target in high and low expression cell lines.
Product Description
Polyclonal antibody raised in rabbit against human KYAT3 (kynurenine aminotransferase 3).
Alternative Gene Names
CCBL2, KAT3, KATIII, RBM1, RP11-82K18.3
Antigen Information
| 항목 | 내용 |
|---|---|
| Antigen Type | Recombinant Protein Epitope Signature Tag (PrEST) antigen |
| Antigen Sequence | VTGWKLGWSIGPNHLIKHLQTVQQNTIYTCATPLQEALAQAFWIDIKRMDDPECYFNSLPKELEVKRDRMVRLLESVG |
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | kynurenine aminotransferase 3 |
| Target Gene | KYAT3 |
| Verified Species Reactivity | Human |
| Interspecies Identity | Mouse (92%), Rat (82%) |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Information
| 항목 | 내용 |
|---|---|
| Composition | 40% glycerol and PBS (pH 7.2) |
| Preservative | 0.02% sodium azide |
| Safety | Material Safety Data Sheet |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



