Atlas Antibodies Anti-KYAT3 Antibody
상품 한눈에 보기
Human KYAT3 단백질을 타깃으로 하는 rabbit polyclonal antibody. IHC와 WB에서 검증됨. PrEST 항원을 이용해 친화 정제됨. Human에 반응하며, Mouse·Rat과 높은 서열 유사성 보유. 40% glycerol/PBS buffer로 안정화됨.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-KYAT3 Antibody
Target: kynurenine aminotransferase 3
Type: Polyclonal Antibody against Human KYAT3
Recommended Applications
- IHC (Independent Antibody Validation): Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein.
- WB (Orthogonal Validation): Orthogonal validation of protein expression using WB by comparison to RNA-seq data of corresponding target in high and low expression cell lines.
Product Description
Polyclonal antibody raised in rabbit against human KYAT3 (kynurenine aminotransferase 3).
Alternative Gene Names
CCBL2, KAT3, KATIII, RBM1, RP11-82K18.3
Antigen Information
| 항목 | 내용 |
|---|---|
| Antigen Type | Recombinant Protein Epitope Signature Tag (PrEST) antigen |
| Antigen Sequence | VTGWKLGWSIGPNHLIKHLQTVQQNTIYTCATPLQEALAQAFWIDIKRMDDPECYFNSLPKELEVKRDRMVRLLESVG |
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | kynurenine aminotransferase 3 |
| Target Gene | KYAT3 |
| Verified Species Reactivity | Human |
| Interspecies Identity | Mouse (92%), Rat (82%) |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Information
| 항목 | 내용 |
|---|---|
| Composition | 40% glycerol and PBS (pH 7.2) |
| Preservative | 0.02% sodium azide |
| Safety | Material Safety Data Sheet |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.