CacheBy
Atlas Antibodies Anti-KYAT3 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-KYAT3 Antibody

상품 한눈에 보기

Human KYAT3 단백질을 타깃으로 하는 rabbit polyclonal antibody. IHC와 WB에서 검증됨. PrEST 항원을 이용해 친화 정제됨. Human에 반응하며, Mouse·Rat과 높은 서열 유사성 보유. 40% glycerol/PBS buffer로 안정화됨.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA026538-100 Anti-KYAT3 Antibody, kynurenine aminotransferase 3 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA026538-25 Anti-KYAT3 Antibody, kynurenine aminotransferase 3 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-KYAT3 Antibody

Anti-KYAT3 Antibody

Target: kynurenine aminotransferase 3
Type: Polyclonal Antibody against Human KYAT3


  • IHC (Independent Antibody Validation): Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein.
  • WB (Orthogonal Validation): Orthogonal validation of protein expression using WB by comparison to RNA-seq data of corresponding target in high and low expression cell lines.

Product Description

Polyclonal antibody raised in rabbit against human KYAT3 (kynurenine aminotransferase 3).


Alternative Gene Names

CCBL2, KAT3, KATIII, RBM1, RP11-82K18.3

Open Datasheet


Antigen Information

항목 내용
Antigen Type Recombinant Protein Epitope Signature Tag (PrEST) antigen
Antigen Sequence VTGWKLGWSIGPNHLIKHLQTVQQNTIYTCATPLQEALAQAFWIDIKRMDDPECYFNSLPKELEVKRDRMVRLLESVG

Target Information

항목 내용
Target Protein kynurenine aminotransferase 3
Target Gene KYAT3
Verified Species Reactivity Human
Interspecies Identity Mouse (92%), Rat (82%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Information

항목 내용
Composition 40% glycerol and PBS (pH 7.2)
Preservative 0.02% sodium azide
Safety Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Validation
IHC Tooltip
WB Validation
WB Tooltip

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.