CacheBy
Atlas Antibodies Anti-KRTCAP3 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-KRTCAP3 Antibody

상품 한눈에 보기

Human KRTCAP3 단백질을 인식하는 토끼 폴리클로날 항체. IHC 및 WB 검증 완료. Orthogonal 및 재조합 발현 기반 검증으로 높은 특이성과 신뢰성 확보. Affinity purified 방식으로 정제된 고품질 항체.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA047136-100 Anti-KRTCAP3 Antibody, keratinocyte associated protein 3 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA047136-25 Anti-KRTCAP3 Antibody, keratinocyte associated protein 3 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-KRTCAP3 Antibody

Anti-KRTCAP3 Antibody

keratinocyte associated protein 3


  • IHC (Orthogonal validation): Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
  • WB (Recombinant expression validation): Recombinant expression validation in WB using target protein overexpression.

Product Description

Polyclonal Antibody against Human KRTCAP3


Alternative Gene Names

  • KCP3

Open Datasheet


Target Information

항목 내용
Target Protein keratinocyte associated protein 3
Target Gene KRTCAP3
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence TLRGVGPCRKDGLQGQLEEMTELESPKCKRQENEQLLDQNQEIRASQRSWV
Verified Species Reactivity Human
Interspecies Information Highest antigen sequence identity:
Mouse ENSMUSG00000029149 (67%)
Rat ENSRNOG00000047941 (67%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition

구성 내용
Buffer 40% glycerol and PBS (pH 7.2)
Preservative 0.02% sodium azide
MSDS Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Orthogonal Validation
Orthogonal Tooltip
WB Recombinant Validation
Recombinant Tooltip

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.