
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-KRTCAP3 Antibody
상품 한눈에 보기
Human KRTCAP3 단백질을 인식하는 토끼 폴리클로날 항체로, IHC와 WB에서 검증됨. Orthogonal 및 재조합 발현 기반 검증 수행. PrEST 항원을 이용한 친화 정제. 인체 시료 연구용으로 적합.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA060203-100 Anti-KRTCAP3 Antibody, keratinocyte associated protein 3 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA060203-25 Anti-KRTCAP3 Antibody, keratinocyte associated protein 3 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-KRTCAP3 Antibody
Anti-KRTCAP3 Antibody
Target: keratinocyte associated protein 3 (KRTCAP3)
Supplier: Atlas Antibodies
Recommended Applications
- IHC (Orthogonal validation): Protein expression validated by comparison to RNA-seq data in high and low expression tissues.
- WB (Recombinant expression validation): Validation using target protein overexpression.
Product Description
Polyclonal antibody against human KRTCAP3.
Alternative Gene Names
- KCP3
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | keratinocyte associated protein 3 |
| Target Gene | KRTCAP3 |
| Antigen Sequence Type | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Antigen Sequence | TLRGVGPCRKDGLQGQLEEMTELESPKCKRQENEQLLDQNQEIRASQRSWV |
Species Reactivity
| 항목 | 내용 |
|---|---|
| Verified Reactivity | Human |
| Ortholog Identity | Rat ENSRNOG00000047941 (67%), Mouse ENSMUSG00000029149 (67%) |
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer
40% glycerol and PBS (pH 7.2).
Contains 0.02% sodium azide as preservative.
Material Safety Data Sheet
Notes
- Gently mix before use.
- Optimal concentrations and conditions should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



