CacheBy
Atlas Antibodies Anti-KRT15 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-KRT15 Antibody

상품 한눈에 보기

인간 KRT15 단백질을 인식하는 토끼 폴리클로날 항체로, IHC, WB, ICC 등 다양한 실험에 적합합니다. RNA-seq 데이터 기반의 정교한 orthogonal 검증을 거쳤으며, PrEST 항원을 이용해 친화 정제되었습니다. CK15, K15 등 대체 유전자명으로도 알려져 있습니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA023910-100 Anti-KRT15 Antibody, keratin 15 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA023910-25 Anti-KRT15 Antibody, keratin 15 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-KRT15 Antibody

Anti-KRT15 Antibody

Target Protein: keratin 15
Product Type: Polyclonal antibody against Human KRT15


  • IHC (Immunohistochemistry)
    Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

  • WB (Western Blot)
    Orthogonal validation of protein expression using WB by comparison to RNA-seq data of corresponding target in high and low expression cell lines.

  • ICC (Immunocytochemistry)


Product Description

Polyclonal antibody against human keratin 15 (KRT15).

Alternative Gene Names: CK15, K15, K1CO
Open Datasheet (PDF)


Antigen Information

  • Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
  • Sequence:
    RLEQEIATYRSLLEGQDAKMAGIGIREASSGGGGSSSNFHINVEESVDGQVVSSHKREI

Species Reactivity

Species Gene ID Sequence Identity
Human KRT15 Verified
Mouse ENSMUSG00000054146 80%
Rat ENSRNOG00000014099 77%

Antibody Characteristics

Property Description
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide added as preservative (Material Safety Data Sheet)
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Orthogonal
WB Orthogonal
ICC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.