
Atlas Antibodies Anti-KRT15 Antibody
인간 KRT15 단백질을 인식하는 토끼 폴리클로날 항체로, IHC, WB, ICC 등 다양한 실험에 적합합니다. RNA-seq 데이터 기반의 정교한 orthogonal 검증을 거쳤으며, PrEST 항원을 이용해 친화 정제되었습니다. CK15, K15 등 대체 유전자명으로도 알려져 있습니다.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-KRT15 Antibody
Target Protein: keratin 15
Product Type: Polyclonal antibody against Human KRT15
Recommended Applications
IHC (Immunohistochemistry)
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.WB (Western Blot)
Orthogonal validation of protein expression using WB by comparison to RNA-seq data of corresponding target in high and low expression cell lines.ICC (Immunocytochemistry)
Product Description
Polyclonal antibody against human keratin 15 (KRT15).
Alternative Gene Names: CK15, K15, K1CO
Open Datasheet (PDF)
Antigen Information
- Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
- Sequence:
RLEQEIATYRSLLEGQDAKMAGIGIREASSGGGGSSSNFHINVEESVDGQVVSSHKREI
Species Reactivity
| Species | Gene ID | Sequence Identity |
|---|---|---|
| Human | KRT15 | Verified |
| Mouse | ENSMUSG00000054146 | 80% |
| Rat | ENSRNOG00000014099 | 77% |
Antibody Characteristics
| Property | Description |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide added as preservative (Material Safety Data Sheet) |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-KRT17 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-KRT15 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-KRT15 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-KRT14 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-KRT13 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|