Atlas Antibodies Anti-KRT13 Antibody
Atlas Antibodies

Atlas Antibodies Anti-KRT13 Antibody

✦상품 한눈에 보기

인간 KRT13 단백질을 인식하는 토끼 폴리클로날 항체입니다. IHC, WB, ICC 등 다양한 응용에 적합하며 RNA-seq 데이터 기반 정교한 정합 검증을 거쳤습니다. 프레스티지 정제 방식으로 높은 특이성과 재현성을 제공합니다.

브랜드: Atlas Antibodies
카테고리 상품 전체보기브랜드 상품 전체보기
#Antibodies#Atlas Antibodies

상품 옵션 정보

다양한 옵션의 상품 정보와 가격을 확인하세요

소모품
HPA069771-100
Atlas Antibodies HPA069771-100 Anti-KRT13 Antibody, keratin 13 100ul
CAS: -단위: 100ul
재고문의재고: -
728,000원
(VAT포함)800,800원
HPA069771-25
Atlas Antibodies HPA069771-25 Anti-KRT13 Antibody, keratin 13 25ul
CAS: -단위: 25ul
재고문의재고: -
528,000원
(VAT포함)580,800원
소모품
HPA069771-100
재고문의재고: -
Atlas Antibodies HPA069771-100 Anti-KRT13 Antibody, keratin 13 100ul
CAS: -단위: 100ul
728,000원
(VAT포함)800,800원
HPA069771-25
재고문의재고: -
Atlas Antibodies HPA069771-25 Anti-KRT13 Antibody, keratin 13 25ul
CAS: -단위: 25ul
528,000원
(VAT포함)580,800원

✨AI 추천 연관 상품

AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요

연관 상품을 찾고 있습니다...

Anti-KRT13 Antibody

Target Protein: Keratin 13
Gene Symbol: KRT13
Supplier: Atlas Antibodies

  • IHC (Immunohistochemistry): Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
  • WB (Western Blot): Orthogonal validation of protein expression using WB by comparison to RNA-seq data of corresponding target in high and low expression cell lines.
  • ICC (Immunocytochemistry)

Product Description

Polyclonal antibody against human KRT13.

Alternative Gene Names: CK13, K13, MGC161462, MGC3781
Clonality: Polyclonal
Host: Rabbit
Isotype: IgG

Antigen Information

  • Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
  • Sequence:
    MSLRLQSSSASYGGGFGGGSCQLGGGRGVSTCSTRFVSGGSAGGYGGGVSCG

Verified Species Reactivity

  • Human

Interspecies Information:
Highest antigen sequence identity to the following orthologs:

Species Gene ID Identity
Mouse ENSMUSG00000044041 81%
Rat ENSRNOG00000014070 81%

Purification and Storage

항목 내용
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Buffer Composition 40% glycerol and PBS (pH 7.2). Contains 0.02% sodium azide as preservative.
Storage Notes Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.

Material Safety Data Sheet

Open Datasheet

제품 이미지

Enhanced Validation
IHC Orthogonal Validation
WB Orthogonal Validation
ICC Application

🏷️Atlas Antibodies 상품 둘러보기

동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies Anti-KRT15 Antibody

Atlas Antibodies

Atlas Antibodies Anti-KRT15 Antibody

528,000원

Atlas Antibodies Anti-KRT14 Antibody

Atlas Antibodies

Atlas Antibodies Anti-KRT14 Antibody

528,000원

Atlas Antibodies Anti-KRT13 Antibody

Atlas Antibodies

Atlas Antibodies Anti-KRT13 Antibody

528,000원

Atlas Antibodies Anti-KRT1 Antibody

Atlas Antibodies

Atlas Antibodies Anti-KRT1 Antibody

528,000원

Atlas Antibodies Anti-KRT12 Antibody

Atlas Antibodies

Atlas Antibodies Anti-KRT12 Antibody

528,000원

배송/결제/교환/반품 안내

배송 정보

기본 배송비
  • - 배송비 3,850원 (부가세 포함)
  • - 10만원 이상 구매시 배송비 무료
  • - 도서산간 및 제주를 포함한 일부 지역 추가비용 발생
  • - 장비의 경우 추가 배송비 및 설치비가 청구 될 수 있습니다
교환/반품 배송비
  • - 상품 별로 상이
착불 배송비
  • - 착불 적용 상품에 개별 부과 (상품 별로 상이)
교환/반품 배송비
  • - 상품 별로 상이

결제 및 환불 안내

결제수단
  • - 신용카드
  • - 가상계좌
  • - 연구비카드
  • - 세금계산서 (기업은행 033-502993-01-019)
  • - 세금계산서 (신한은행 100-032-703829)
  • - 상품 결제 후 최대 60일 이내 제공 완료
취소
  • - 취소 접수 후 3 ~ 5일 이내 환불 처리
반품
  • - 반품 접수 후 3 ~ 5일 이내 환불 처리
환급
  • - 회사는 회원이 구매신청한 상품 등이 품절 등의 사유로 인도 또는 제공할 수 없을 때에는 지체 없이 그 사유를 회원에게 통지하고,
      사전에 상품 등의 대금을 받은 경우에는 대금을 받은 날로부터 3영업일 이내에 환급하거나 환급에 필요한 조치를 취합니다.

교환 및 반품 접수

교환 및 반품 접수 기한
  • - 상품 수령일로부터 7일 이내
교환 및 반품 접수가 가능한 경우
  • - 제품의 하자는 없지만, 다른 상품으로 교환하거나 반품 원하는 경우
     (배송비 고객 부담)
  • - 상품자체 불량 및 하자에 의한 경우
  • - 상품 오배송에 의한 경우
교환 및 반품 접수가 불가능한 경우
  • - 상품 수령 후 7일을 초과한 경우
  • - 개별 포장 상품의 포장을 훼손한 경우
  • - 고객의 고의적인 귀책으로 상품가치가 훼손된 경우
  • - 주문제작을 통해서 제품을 생산하는 경우
  • - 주문 당시 재고가 없어서 해외를 통해 제품을 수입해서 구매하는 경우

교환 및 반품 신청

교환 절차
  • - 상품 불량/오배송/상품파손
  • - 전화(02-585-1342) 또는 info@cacheby.com에 상품교환 접수
반품 절차
  • - 반품할 품목을 확인 후 info@cacheby.com로 반품 신청 (수령 후 7일 이내 가능하며 이후 불가)
  • - 전달드린 주문번호와 함께 반품 상품을 포장
     (포장을 꼼꼼하게 해주셔야 반품 상품 손상에 따른 불이익이 없습니다.)
  • - 택배회사 방문 시 반품 상품 전달
     (택배사의 반송장은 상품 교환이 완료될 때까지 보관해주시기 바랍니다.)
  • - 회수된 제품 확인 후 하자없을시 배송비를 제외하고 환불 처리 진행
     (환불 처리 후 입금까지 최대 2주까지 소요될 수 있습니다.)

문의 0