Atlas Antibodies Anti-KRT13 Antibody

상품 한눈에 보기

인간 KRT13 단백질을 인식하는 토끼 폴리클로날 항체입니다. IHC, WB, ICC 등 다양한 응용에 적합하며 RNA-seq 데이터 기반 정교한 정합 검증을 거쳤습니다. 프레스티지 정제 방식으로 높은 특이성과 재현성을 제공합니다.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA069771-100 Anti-KRT13 Antibody, keratin 13 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA069771-25 Anti-KRT13 Antibody, keratin 13 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Target Protein: Keratin 13
Gene Symbol: KRT13
Supplier: Atlas Antibodies

IHC (Immunohistochemistry): Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
WB (Western Blot): Orthogonal validation of protein expression using WB by comparison to RNA-seq data of corresponding target in high and low expression cell lines.
ICC (Immunocytochemistry)

Polyclonal antibody against human KRT13.

Alternative Gene Names: CK13, K13, MGC161462, MGC3781
Clonality: Polyclonal
Host: Rabbit
Isotype: IgG

Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence:
MSLRLQSSSASYGGGFGGGSCQLGGGRGVSTCSTRFVSGGSAGGYGGGVSCG

Interspecies Information:
Highest antigen sequence identity to the following orthologs:

Species	Gene ID	Identity
Mouse	ENSMUSG00000044041	81%
Rat	ENSRNOG00000014070	81%

항목	내용
Purification Method	Affinity purified using the PrEST antigen as affinity ligand
Buffer Composition	40% glycerol and PBS (pH 7.2). Contains 0.02% sodium azide as preservative.
Storage Notes	Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.