
Atlas Antibodies Anti-KRT13 Antibody
상품 한눈에 보기
인체 KRT13 단백질을 표적으로 하는 폴리클로날 항체로, IHC 및 WB에서 RNA-seq 데이터와의 정합 검증을 통해 단백질 발현을 확인함. Rabbit 호스트, IgG 아이소타입, PrEST 항원 기반 친화 정제 방식으로 제조됨. Human 반응성 확인.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-KRT13 Antibody
Target Information
- Target Protein: keratin 13
- Target Gene: KRT13
- Alternative Gene Names: CK13, K13, MGC161462, MGC3781
Recommended Applications
- IHC (Orthogonal Validation): Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
- WB (Orthogonal Validation): Orthogonal validation of protein expression using WB by comparison to RNA-seq data of corresponding target in high and low expression cell lines.
- ICC: Immunocytochemistry application supported.
Product Description
Polyclonal Antibody against Human KRT13
Antigen Sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:MSLRLQSSSASYGGGFGGGSCQLGGGRGVSTCSTRFVSGGSAGGYGGGVSCG
Verified Species Reactivity
- Human
Interspecies Information
| Species | Gene ID | Sequence Identity |
|---|---|---|
| Mouse | ENSMUSG00000044041 | 81% |
| Rat | ENSRNOG00000014070 | 81% |
Antibody Characteristics
| Property | Specification |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
- Material Safety Data Sheet
Datasheet
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.
