Atlas Antibodies Anti-KRT13 Antibody

상품 한눈에 보기

인체 KRT13 단백질을 표적으로 하는 폴리클로날 항체로, IHC 및 WB에서 RNA-seq 데이터와의 정합 검증을 통해 단백질 발현을 확인함. Rabbit 호스트, IgG 아이소타입, PrEST 항원 기반 친화 정제 방식으로 제조됨. Human 반응성 확인.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA030877-100 Anti-KRT13 Antibody, keratin 13 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA030877-25 Anti-KRT13 Antibody, keratin 13 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

IHC (Orthogonal Validation): Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
WB (Orthogonal Validation): Orthogonal validation of protein expression using WB by comparison to RNA-seq data of corresponding target in high and low expression cell lines.
ICC: Immunocytochemistry application supported.

Polyclonal Antibody against Human KRT13

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:
MSLRLQSSSASYGGGFGGGSCQLGGGRGVSTCSTRFVSGGSAGGYGGGVSCG

Species	Gene ID	Sequence Identity
Mouse	ENSMUSG00000044041	81%
Rat	ENSRNOG00000014070	81%

Property	Specification
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method	Affinity purified using the PrEST antigen as affinity ligand