Atlas Antibodies Anti-KRR1 Antibody

상품 한눈에 보기

Human KRR1 단백질을 표적으로 하는 폴리클로날 항체로, IHC, WB, ICC에 적합합니다. siRNA knockdown을 통한 유전적 검증 완료. Rabbit 유래 IgG이며, PrEST 항원으로 친화 정제됨. Human, Mouse, Rat 반응성 확인.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA051690-100 Anti-KRR1 Antibody, KRR1, small subunit (SSU) processome component, homolog (yeast) 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA051690-25 Anti-KRR1 Antibody, KRR1, small subunit (SSU) processome component, homolog (yeast) 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Target: KRR1, small subunit (SSU) processome component, homolog (yeast)

Polyclonal antibody against Human KRR1

HRB2, RIP-1

항목	내용
Target Protein	KRR1, small subunit (SSU) processome component, homolog (yeast)
Target Gene	KRR1
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity	Human, Mouse, Rat
Interspecies Identity	Mouse ENSMUSG00000063334 (91%), Rat ENSRNOG00000004035 (91%)

Antigen Sequence

LKANQKKRQKMEAIKAKQAEAISKRQEERNKAFIPPKEKPIVKPKEASTETKIDVASIKEKVKKAKNKKLGALTAEEIALKMEAD

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Purification Method	Affinity purified using the PrEST antigen as affinity ligand
Buffer	40% glycerol and PBS (pH 7.2). Contains 0.02% sodium azide as preservative. Material Safety Data Sheet