CacheBy
Thermo Fisher Scientific DNAJC10 Polyclonal Antibody
원본

Thermo Fisher Scientific DNAJC10 Polyclonal Antibody

상품 한눈에 보기

DNAJC10 단백질을 인식하는 Rabbit Polyclonal 항체로, Human, Mouse, Rat 시료에 반응합니다. Western blot과 ELISA에 적합하며, Affinity Chromatography로 정제되었습니다. PBS/glycerol 용액 형태로 제공되며, -20°C에서 보관합니다.

카탈로그번호
PA588451
판매단위
pk
카탈로그 보기

카탈로그

1개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
마지막 업데이트 2025. 08. 05. 오후 03:16
Thermo Fisher Scientific PA588451 DNAJC10 Polyclonal Antibody 100 ul pk판매 단위 pk ·
재고 확인 필요
618,800원VAT 포함 680,680원

Thermo Fisher Scientific · Thermo Fisher Scientific DNAJC10 Polyclonal Antibody

Applications and Tested Dilution

Application Tested Dilution
Western Blot (WB) 1:500–1:2,000
ELISA 1 µg/mL

Product Specifications

항목 내용
Species Reactivity Human, Mouse, Rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 614–793 of human DNAJC10 (NP_0618541)
Conjugate Unconjugated
Form Liquid
Concentration 0.12 mg/mL
Purification Affinity Chromatography
Storage Buffer PBS, pH 7.3, with 50% glycerol
Contains 0.01% thimerosal
Storage Conditions -20°C, Avoid Freeze/Thaw Cycles
Shipping Conditions Wet ice
RRID AB_2804924

Product Specific Information

Immunogen sequence:
IDCQQYHSFCAQENVQRYPEIRFFPPKSNKAYHYHSYNGWNRDAYSLRIWGLGFLPQVSTDLTPQTFSEKVLQGKNHWVIDFYAPWCGPCQNFAPEFELLARMIKGKVKAGKVDCQAYAQTCQKAGIRAYPTVKFYFYERAKRNFQEEQINTRDAKAAALISEKLETLRNQGKRNKDEL

Positive Samples:
U-87MG, HT-29, SK-OV-3, Raji, SGC-7901, Mouse pancreas, Mouse lung

Cellular Location:
Endoplasmic reticulum lumen

Target Information

This endoplasmic reticulum co-chaperone may play a role in protein folding and translocation across the endoplasmic reticulum membrane. DNAJC10 may act as a co-chaperone for HSPA5.

Safety Information

WARNING: This product can expose you to chemicals including mercury, which is known to the State of California to cause birth defects or other reproductive harm.
For more information, visit www.P65Warnings.ca.gov.


For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.

Thermo Fisher Scientific 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.