Thermo Fisher Scientific DNAJC10 Polyclonal Antibody
DNAJC10 단백질을 인식하는 Rabbit Polyclonal 항체로, Human, Mouse, Rat 시료에 반응합니다. Western blot과 ELISA에 적합하며, Affinity Chromatography로 정제되었습니다. PBS/glycerol 용액 형태로 제공되며, -20°C에서 보관합니다.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Applications and Tested Dilution
| Application | Tested Dilution |
|---|---|
| Western Blot (WB) | 1:500–1:2,000 |
| ELISA | 1 µg/mL |
Product Specifications
| 항목 | 내용 |
|---|---|
| Species Reactivity | Human, Mouse, Rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 614–793 of human DNAJC10 (NP_0618541) |
| Conjugate | Unconjugated |
| Form | Liquid |
| Concentration | 0.12 mg/mL |
| Purification | Affinity Chromatography |
| Storage Buffer | PBS, pH 7.3, with 50% glycerol |
| Contains | 0.01% thimerosal |
| Storage Conditions | -20°C, Avoid Freeze/Thaw Cycles |
| Shipping Conditions | Wet ice |
| RRID | AB_2804924 |
Product Specific Information
Immunogen sequence:
IDCQQYHSFCAQENVQRYPEIRFFPPKSNKAYHYHSYNGWNRDAYSLRIWGLGFLPQVSTDLTPQTFSEKVLQGKNHWVIDFYAPWCGPCQNFAPEFELLARMIKGKVKAGKVDCQAYAQTCQKAGIRAYPTVKFYFYERAKRNFQEEQINTRDAKAAALISEKLETLRNQGKRNKDEL
Positive Samples:
U-87MG, HT-29, SK-OV-3, Raji, SGC-7901, Mouse pancreas, Mouse lung
Cellular Location:
Endoplasmic reticulum lumen
Target Information
This endoplasmic reticulum co-chaperone may play a role in protein folding and translocation across the endoplasmic reticulum membrane. DNAJC10 may act as a co-chaperone for HSPA5.
Safety Information
⚠ WARNING: This product can expose you to chemicals including mercury, which is known to the State of California to cause birth defects or other reproductive harm.
For more information, visit www.P65Warnings.ca.gov.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
🏷️Thermo Fisher Scientific 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요
Thermo Fisher Scientific
Thermo Fisher Scientific CIP2A Polyclonal Antibody
618,800원
Thermo Fisher Scientific
Thermo Fisher Scientific HSF2 Polyclonal Antibody
618,800원
Thermo Fisher Scientific
Thermo Fisher Scientific DNAJC10 Polyclonal Antibody
618,800원
Thermo Fisher Scientific
Thermo Fisher Scientific ALDH2 Polyclonal Antibody
618,800원
Thermo Fisher Scientific
Thermo Fisher Scientific SIPA1 Polyclonal Antibody
618,800원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|