
Atlas Antibodies Anti-KCTD6 Antibody
상품 한눈에 보기
인간 KCTD6 단백질을 표적으로 하는 폴리클로날 항체로, IHC와 WB에 적합합니다. 재조합 발현 검증 완료된 고품질 항체이며, 친화 정제 방식으로 높은 특이성과 재현성을 제공합니다. 토끼 유래 IgG 형식으로 PBS와 글리세롤 버퍼에 보존됩니다.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-KCTD6 Antibody
Target: Potassium channel tetramerization domain containing 6 (KCTD6)
Type: Polyclonal antibody against Human KCTD6
Recommended Applications
- Immunohistochemistry (IHC)
- Western Blot (WB)
Validation: Recombinant expression validation in WB using target protein overexpression.
Product Description
Polyclonal Antibody against Human KCTD6
Alternative Gene Names
- KCASH3
- MGC27385
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | Potassium channel tetramerization domain containing 6 |
| Target Gene | KCTD6 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Sequence | QIEPLIQCLNDPKPLYPMDTFEEVVELSSTRKLSKYSNPVAVIITQLTITTKVHSLLEGISNYFTKWNKHM |
Verified Species Reactivity
- Human
Interspecies Information
Highest antigen sequence identity to the following orthologs:
- Rat ENSRNOG00000007817 (100%)
- Mouse ENSMUSG00000021752 (99%)
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet) |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-KDELC1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-KCTD8 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-KCTD6 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-KCTD9 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-KCTD6 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.