
Atlas Antibodies Anti-KCTD6 Antibody
상품 한눈에 보기
Human KCTD6 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 및 WB(재조합 발현) 검증 완료. PrEST 항원 기반 친화 정제 방식으로 높은 특이성과 재현성 제공. Human에 반응하며 Rat, Mouse와 높은 서열 유사성 보유.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-KCTD6 Antibody
Target: Potassium channel tetramerization domain containing 6 (KCTD6)
Type: Polyclonal antibody against Human KCTD6
Recommended Applications
- IHC (Immunohistochemistry)
- WB (Western Blot, Recombinant Expression)
Recombinant expression validation in WB using target protein overexpression.
Product Description
Polyclonal antibody raised in rabbit against human KCTD6 protein.
Alternative Gene Names
KCASH3, MGC27385
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | Potassium channel tetramerization domain containing 6 |
| Target Gene | KCTD6 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Epitope Sequence | QIEPLIQCLNDPKPLYPMDTFEEVVELSSTRKLSKYSNPVAVIITQLTITTKVHSLLEGISNYFTKWNKHM |
| Verified Species Reactivity | Human |
| Interspecies Identity | Rat ENSRNOG00000007817 (100%), Mouse ENSMUSG00000021752 (99%) |
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative |
| MSDS | Material Safety Data Sheet |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-KCTD6 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-KCTD9 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-KCTD6 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-KCTD21 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-KCTD3 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.