
Atlas Antibodies Anti-KATNBL1 Antibody
상품 한눈에 보기
Human KATNBL1 단백질을 인식하는 Rabbit Polyclonal 항체로, IHC, WB, ICC 분석에 적합. PrEST 항원을 이용해 Affinity 정제됨. 인간에 대해 검증되었으며, 마우스·랫과 높은 서열 유사성 보유. PBS/glycerol buffer에 보존.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-KATNBL1 Antibody
Target: katanin p80 subunit B-like 1 (KATNBL1)
Supplier: Atlas Antibodies
Recommended Applications
- IHC (Immunohistochemistry)
- WB (Western Blot)
- ICC (Immunocytochemistry)
Product Description
Polyclonal antibody against human KATNBL1.
Alternative Gene Names
C15orf29, FLJ22557
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | katanin p80 subunit B-like 1 |
| Target Gene | KATNBL1 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Epitope Sequence | KQSPGSGGCDMANKENELACAGHLPEKLHHDSRTYLVNSSDSGSSQTESPSSKY |
| Verified Species Reactivity | Human |
| Interspecies Identity | Mouse ENSMUSG00000027132 (87%), Rat ENSRNOG00000005814 (87%) |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Information
| 항목 | 내용 |
|---|---|
| Buffer Composition | 40% glycerol and PBS (pH 7.2) |
| Preservative | 0.02% sodium azide |
| Safety Data Sheet | Material Safety Data Sheet |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-KBTBD11 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-KAZN Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-KATNBL1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-KAZALD1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-KATNB1 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.