원본

Atlas Antibodies Anti-KBTBD11 Antibody

상품 한눈에 보기

인간 KBTBD11 단백질을 인식하는 폴리클로날 항체로 IHC, WB, ICC에 적합합니다. Rabbit 유래 IgG 항체이며, PrEST 항원을 사용해 친화 정제되었습니다. Human에 반응성이 검증되었으며, Mouse 및 Rat과 높은 서열 유사성을 가집니다.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA051159-100 Anti-KBTBD11 Antibody, kelch repeat and BTB (POZ) domain containing 11 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA051159-25 Anti-KBTBD11 Antibody, kelch repeat and BTB (POZ) domain containing 11 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Target: kelch repeat and BTB (POZ) domain containing 11
Product Type: Polyclonal Antibody against Human KBTBD11

Polyclonal antibody raised in rabbit against the human KBTBD11 protein (kelch repeat and BTB (POZ) domain containing 11).

항목	내용
Target Protein	kelch repeat and BTB (POZ) domain containing 11
Target Gene	KBTBD11
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence	YRLLKYDPRRDEWQECPCSSSRERSADMVALDGFIYRFDLSGSRGEAQAAGPSGVSVSRYHCLAKQWSPCV

Highest antigen sequence identity to the following orthologs:

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method	Affinity purified using the PrEST antigen as affinity ligand