
원본
Atlas Antibodies Anti-KBTBD11 Antibody
상품 한눈에 보기
인간 KBTBD11 단백질을 인식하는 폴리클로날 항체로 IHC, WB, ICC에 적합합니다. Rabbit 유래 IgG 항체이며, PrEST 항원을 사용해 친화 정제되었습니다. Human에 반응성이 검증되었으며, Mouse 및 Rat과 높은 서열 유사성을 가집니다.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA051159-100 Anti-KBTBD11 Antibody, kelch repeat and BTB (POZ) domain containing 11 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA051159-25 Anti-KBTBD11 Antibody, kelch repeat and BTB (POZ) domain containing 11 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-KBTBD11 Antibody
Anti-KBTBD11 Antibody
Target: kelch repeat and BTB (POZ) domain containing 11
Product Type: Polyclonal Antibody against Human KBTBD11
Recommended Applications
- Immunohistochemistry (IHC)
- Western Blot (WB)
- Immunocytochemistry (ICC)
Product Description
Polyclonal antibody raised in rabbit against the human KBTBD11 protein (kelch repeat and BTB (POZ) domain containing 11).
Alternative Gene Names
- KIAA0711
- KLHDC7C
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | kelch repeat and BTB (POZ) domain containing 11 |
| Target Gene | KBTBD11 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Epitope Sequence | YRLLKYDPRRDEWQECPCSSSRERSADMVALDGFIYRFDLSGSRGEAQAAGPSGVSVSRYHCLAKQWSPCV |
Verified Species Reactivity
- Human
Interspecies Information
Highest antigen sequence identity to the following orthologs:
- Mouse ENSMUSG00000055675 (88%)
- Rat ENSRNOG00000012333 (86%)
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



