
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-IST1 Antibody
상품 한눈에 보기
Human IST1 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 및 WB 검증에 적합. PrEST 항원을 이용한 친화 정제 방식으로 높은 특이성과 재현성 제공. 사람, 생쥐, 랫트 간 높은 서열 유사성(99%) 확인. 안정한 PBS 버퍼에 보존제 포함.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA041802-100 Anti-IST1 Antibody, increased sodium tolerance 1 homolog (yeast) 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA041802-25 Anti-IST1 Antibody, increased sodium tolerance 1 homolog (yeast) 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-IST1 Antibody
Anti-IST1 Antibody
Target: increased sodium tolerance 1 homolog (yeast)
Type: Polyclonal Antibody against Human IST1
Recommended Applications
- Immunohistochemistry (IHC)
- Western Blot (WB)
Independent validation: Protein expression validated in WB by comparing independent antibodies targeting different epitopes of the protein.
Product Description
Polyclonal antibody targeting the human IST1 protein, produced in rabbit and affinity purified using the PrEST antigen.
Alternative Gene Names
- KIAA0174
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | increased sodium tolerance 1 homolog (yeast) |
| Target Gene | IST1 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Verified Species Reactivity | Human |
| Interspecies Identity | Mouse ENSMUSG00000031729 (99%), Rat ENSRNOG00000015144 (99%) |
Antigen Sequence:
APRLQSEVAELKIVADQLCAKYSKEYGKLCRTNQIGTVNDRLMHKLSVEAPPKILVERYLIEIAKNYNVPYEPDSVVMAEAPPGVETDLIDVGFTDD
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (MSDS) |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



