
Atlas Antibodies Anti-IST1 Antibody
상품 한눈에 보기
Human IST1 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 및 WB 검증에 적합. PrEST 항원을 이용한 친화 정제 방식으로 높은 특이성과 재현성 제공. 사람, 생쥐, 랫트 간 높은 서열 유사성(99%) 확인. 안정한 PBS 버퍼에 보존제 포함.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-IST1 Antibody
Target: increased sodium tolerance 1 homolog (yeast)
Type: Polyclonal Antibody against Human IST1
Recommended Applications
- Immunohistochemistry (IHC)
- Western Blot (WB)
Independent validation: Protein expression validated in WB by comparing independent antibodies targeting different epitopes of the protein.
Product Description
Polyclonal antibody targeting the human IST1 protein, produced in rabbit and affinity purified using the PrEST antigen.
Alternative Gene Names
- KIAA0174
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | increased sodium tolerance 1 homolog (yeast) |
| Target Gene | IST1 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Verified Species Reactivity | Human |
| Interspecies Identity | Mouse ENSMUSG00000031729 (99%), Rat ENSRNOG00000015144 (99%) |
Antigen Sequence:
APRLQSEVAELKIVADQLCAKYSKEYGKLCRTNQIGTVNDRLMHKLSVEAPPKILVERYLIEIAKNYNVPYEPDSVVMAEAPPGVETDLIDVGFTDD
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (MSDS) |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.
