CacheBy
Atlas Antibodies Anti-IST1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-IST1 Antibody

상품 한눈에 보기

Human IST1 단백질을 인식하는 Rabbit Polyclonal 항체로, IHC 및 WB에 적합. PrEST 항원을 이용해 Affinity 정제되었으며, 높은 종간 보존성을 가짐. 40% glycerol 기반 PBS buffer에 보존제로 sodium azide 포함.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA054532-100 Anti-IST1 Antibody, increased sodium tolerance 1 homolog (yeast) 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA054532-25 Anti-IST1 Antibody, increased sodium tolerance 1 homolog (yeast) 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-IST1 Antibody

Anti-IST1 Antibody

Target: increased sodium tolerance 1 homolog (yeast)
Clonality: Polyclonal
Host: Rabbit
Isotype: IgG


  • Immunohistochemistry (IHC)
  • Western Blot (WB)

Independent antibody validation:
Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein.


Product Description

Polyclonal antibody against Human IST1.


Alternative Gene Names

  • KIAA0174

Target Information

항목 내용
Target Protein increased sodium tolerance 1 homolog (yeast)
Target Gene IST1
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence APRLQSEVAELKIVADQLCAKYSKEYGKLCRTNQIGTVNDRLMHKLSVEAPPKILVERYLIEIAKNYNVPYEPDSVVMAEAPPGVETDLIDVGFTDD
Verified Species Reactivity Human
Interspecies Identity Mouse ENSMUSG00000031729 (99%), Rat ENSRNOG00000015144 (99%)

Purification & Buffer

항목 내용
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Buffer Composition 40% glycerol and PBS (pH 7.2), 0.02% sodium azide as preservative
MSDS Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

Additional Information

Open Datasheet


제품 이미지

Enhanced Validation
IHC Application
WB Application
Independent Validation

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.