Atlas Antibodies Anti-IRF6 Antibody
인간 IRF6 단백질을 인식하는 토끼 폴리클로날 항체로, IHC, WB, ICC 등 다양한 응용에 적합합니다. Orthogonal 및 Independent validation을 통해 높은 신뢰도의 단백질 발현 검증을 제공합니다. PrEST 항원을 이용해 친화 정제된 고품질 항체입니다.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-IRF6 Antibody
Target: Interferon Regulatory Factor 6 (IRF6)
Type: Polyclonal Antibody against Human IRF6
Recommended Applications
IHC (Orthogonal Validation)
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.WB (Independent Validation)
Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein.ICC
Suitable for immunocytochemistry applications.
Product Description
Polyclonal antibody targeting human IRF6, validated for multiple applications.
Alternative Gene Names
LPS, OFC6, VWS, VWS1
Specifications
| 항목 | 내용 |
|---|---|
| Target Protein | Interferon regulatory factor 6 |
| Target Gene | IRF6 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Verified Species Reactivity | Human |
| Interspecies Information | Rat ENSRNOG00000005082 (96%), Mouse ENSMUSG00000026638 (95%) |
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
Antigen Sequence
KSREFNLMYDGTKEVPMNPVKIYQVCDIPQPQGSIINPGSTGSAPWDEKDNDVDEE제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|