
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-IRF6 Antibody
상품 한눈에 보기
Human IRF6를 표적으로 하는 고품질 Polyclonal Rabbit IgG 항체로, IHC, WB, ICC 등 다양한 응용에 적합. Orthogonal 및 Independent validation으로 신뢰성 검증 완료. PrEST 항원 기반 Affinity purification으로 높은 특이성과 재현성 제공.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA076162-100 Anti-IRF6 Antibody, interferon regulatory factor 6 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA076162-25 Anti-IRF6 Antibody, interferon regulatory factor 6 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-IRF6 Antibody
Anti-IRF6 Antibody
Target: Interferon Regulatory Factor 6 (IRF6)
Supplier: Atlas Antibodies
Recommended Applications
- IHC (Orthogonal Validation): Protein expression verified by comparison to RNA-seq data of high and low expression tissues.
- WB (Independent Validation): Protein expression confirmed using independent antibodies recognizing different epitopes.
- ICC (Immunocytochemistry): Suitable for cellular localization studies.
Product Description
Polyclonal antibody against Human IRF6
Alternative Gene Names
LPS, OFC6, VWS, VWS1
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | Interferon regulatory factor 6 |
| Target Gene | IRF6 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Sequence | KSREFNLMYDGTKEVPMNPVKIYQVCDIPQPQGSIINPGSTGSAPWDEKDNDVDEE |
| Verified Species Reactivity | Human |
| Interspecies Identity | Rat (96%), Mouse (95%) |
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative |
| Purification Method | Affinity purified using PrEST antigen as affinity ligand |
Notes
- 사용 전 부드럽게 혼합하십시오.
- 각 응용 분야에 맞는 최적 농도 및 조건은 사용자가 직접 결정해야 합니다.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



