CacheBy
Atlas Antibodies Anti-INTS5 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-INTS5 Antibody

상품 한눈에 보기

Human INTS5 단백질을 인식하는 폴리클로날 항체로, Rabbit에서 생산됨. Affinity purification 방식으로 정제되어 높은 특이성과 재현성을 제공. ICC 등 다양한 응용에 적합하며 Human에 대해 검증됨.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA046181-100 Anti-INTS5 Antibody, integrator complex subunit 5 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA046181-25 Anti-INTS5 Antibody, integrator complex subunit 5 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-INTS5 Antibody

Anti-INTS5 Antibody

Target: integrator complex subunit 5 (INTS5)
Supplier: Atlas Antibodies


  • ICC (Immunocytochemistry)

Product Description

Polyclonal antibody against Human INTS5.


Alternative Gene Names

  • INT5
  • KIAA1698

Open Datasheet


Target Information

항목 내용
Target Protein integrator complex subunit 5
Target Gene INTS5
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence TNRRHTAAVPGPGGIWSVFHAGVIGRGLKPPKFVQSRNQQEVIYNTQSLLSLLVHCCSAPGGTECGECWGAPILSPEAAKAVAVTLVESVCPDAA

Species Reactivity

  • Verified: Human

Interspecies Information

Highest antigen sequence identity to:

  • Mouse (ENSMUSG00000071652): 88%
  • Rat (ENSRNOG00000026005): 87%

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Recommended Applications - ICC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.