
Atlas Antibodies Anti-INTS5 Antibody
상품 한눈에 보기
Human INTS5 단백질을 인식하는 폴리클로날 항체로, Rabbit에서 생산됨. Affinity purification 방식으로 정제되어 높은 특이성과 재현성을 제공. ICC 등 다양한 응용에 적합하며 Human에 대해 검증됨.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-INTS5 Antibody
Target: integrator complex subunit 5 (INTS5)
Supplier: Atlas Antibodies
Recommended Applications
- ICC (Immunocytochemistry)
Product Description
Polyclonal antibody against Human INTS5.
Alternative Gene Names
- INT5
- KIAA1698
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | integrator complex subunit 5 |
| Target Gene | INTS5 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Epitope Sequence | TNRRHTAAVPGPGGIWSVFHAGVIGRGLKPPKFVQSRNQQEVIYNTQSLLSLLVHCCSAPGGTECGECWGAPILSPEAAKAVAVTLVESVCPDAA |
Species Reactivity
- Verified: Human
Interspecies Information
Highest antigen sequence identity to:
- Mouse (ENSMUSG00000071652): 88%
- Rat (ENSRNOG00000026005): 87%
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Composition
- 40% glycerol and PBS (pH 7.2)
- 0.02% sodium azide (preservative)
Material Safety Data Sheet
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-INTS7 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-INTS6L Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-INTS5 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-INTS4 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-INTS13 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.