
Atlas Antibodies Anti-INTS4 Antibody
상품 한눈에 보기
Human INTS4 단백질을 표적으로 하는 Rabbit Polyclonal Antibody로, IHC, WB, ICC 응용에 적합. PrEST 항원을 이용해 친화 정제되었으며, 높은 종간 서열 일치도(98% Mouse, 97% Rat)를 보임. PBS/glycerol buffer에 sodium azide 보존제 포함.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-INTS4 Antibody
Target: Integrator complex subunit 4 (INTS4)
Type: Polyclonal Antibody against Human INTS4
Recommended Applications
- Immunohistochemistry (IHC)
- Western Blot (WB)
- Immunocytochemistry (ICC)
Product Description
Polyclonal antibody raised in rabbit against human INTS4.
Alternative Gene Names
INT4, MGC16733, MST093
Antigen Information
Antigen Sequence (PrEST antigen):
RVYEEFTKVVQPQEEIATKKLRLTKPSKSAALHIDLCKATSPADALQYLLQFARKPVEAESVEGVVRILLEHYYKENDPSVRLKIASLLGLLSKTAGFSPDCI
Verified Species Reactivity
Human
Interspecies Information
Highest antigen sequence identity to orthologs:
- Mouse (ENSMUSG00000025133): 98%
- Rat (ENSRNOG00000012552): 97%
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using PrEST antigen |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative |
| Safety Data | Material Safety Data Sheet |
Notes
- Gently mix before use.
- Optimal concentrations and conditions should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-INTS6L Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-INTS5 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-INTS4 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-INTS13 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-INTS2 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.