
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-INTS4 Antibody
상품 한눈에 보기
Human INTS4 단백질을 표적으로 하는 Rabbit Polyclonal Antibody로, IHC, WB, ICC 응용에 적합. PrEST 항원을 이용해 친화 정제되었으며, 높은 종간 서열 일치도(98% Mouse, 97% Rat)를 보임. PBS/glycerol buffer에 sodium azide 보존제 포함.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA042378-100 Anti-INTS4 Antibody, integrator complex subunit 4 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA042378-25 Anti-INTS4 Antibody, integrator complex subunit 4 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-INTS4 Antibody
Anti-INTS4 Antibody
Target: Integrator complex subunit 4 (INTS4)
Type: Polyclonal Antibody against Human INTS4
Recommended Applications
- Immunohistochemistry (IHC)
- Western Blot (WB)
- Immunocytochemistry (ICC)
Product Description
Polyclonal antibody raised in rabbit against human INTS4.
Alternative Gene Names
INT4, MGC16733, MST093
Antigen Information
Antigen Sequence (PrEST antigen):
RVYEEFTKVVQPQEEIATKKLRLTKPSKSAALHIDLCKATSPADALQYLLQFARKPVEAESVEGVVRILLEHYYKENDPSVRLKIASLLGLLSKTAGFSPDCI
Verified Species Reactivity
Human
Interspecies Information
Highest antigen sequence identity to orthologs:
- Mouse (ENSMUSG00000025133): 98%
- Rat (ENSRNOG00000012552): 97%
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using PrEST antigen |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative |
| Safety Data | Material Safety Data Sheet |
Notes
- Gently mix before use.
- Optimal concentrations and conditions should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



