CacheBy
Atlas Antibodies Anti-IMPG1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-IMPG1 Antibody

상품 한눈에 보기

Human IMPG1 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 등 단백질 발현 검증에 적합. PrEST 항원을 이용해 친화 정제되었으며, 높은 특이성과 재현성을 제공. Human에 반응하며, Rat 및 Mouse와 부분적 교차 반응 가능.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA030333-100 Anti-IMPG1 Antibody, interphotoreceptor matrix proteoglycan 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA030333-25 Anti-IMPG1 Antibody, interphotoreceptor matrix proteoglycan 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-IMPG1 Antibody

Anti-IMPG1 Antibody

Target: interphotoreceptor matrix proteoglycan 1 (IMPG1)
Supplier: Atlas Antibodies


Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein.


Product Description

Polyclonal antibody against Human IMPG1.

Alternative Gene Names: GP147, IPM150, SPACR
Open Datasheet (PDF)


Target Information

항목 내용
Target Protein Interphotoreceptor matrix proteoglycan 1
Target Gene IMPG1
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Identity Rat ENSRNOG00000012479 (60%), Mouse ENSMUSG00000032343 (54%)

Antigen Sequence:
NERTEEAECRCKPGYDSQGSLDGLEPGLCGPGTKECEVLQGKGAPCRLPDHSENQAYKTSVKKFQNQQNNKVISKRNSELLTVEYEEFNHQDWEGN


Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition

40% glycerol and PBS (pH 7.2).
0.02% sodium azide is added as preservative.
Material Safety Data Sheet


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Independent Validation
Independent Validation Tooltip

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.