CacheBy
Atlas Antibodies Anti-IMPG1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-IMPG1 Antibody

상품 한눈에 보기

Human IMPG1 단백질을 표적으로 하는 토끼 폴리클로날 항체로, IHC 독립 검증을 통해 단백질 발현을 확인함. 고순도 Affinity 정제 방식으로 제조되었으며, 인간에 대한 반응성이 검증됨. 시약 안정성을 위해 글리세롤 및 PBS 버퍼에 보존됨.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA030332-100 Anti-IMPG1 Antibody, interphotoreceptor matrix proteoglycan 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA030332-25 Anti-IMPG1 Antibody, interphotoreceptor matrix proteoglycan 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-IMPG1 Antibody

Anti-IMPG1 Antibody

Target: Interphotoreceptor Matrix Proteoglycan 1 (IMPG1)
Supplier: Atlas Antibodies


Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein.


Product Description

Polyclonal antibody against human IMPG1.


Alternative Gene Names

GP147, IPM150, SPACR


Target Information

항목 내용
Target Protein Interphotoreceptor matrix proteoglycan 1
Target Gene IMPG1
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Identity Rat ENSRNOG00000012479 (60%), Mouse ENSMUSG00000032343 (54%)

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet)

Antigen Sequence

NERTEEAECRCKPGYDSQGSLDGLEPGLCGPGTKECEVLQGKGAPCRLPDHSENQAYKTSVKKFQNQQNNKVISKRNSELLTVEYEEFNHQDWEGN

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

Reference

Open Datasheet (PDF)


제품 이미지

Enhanced Validation
IHC Independent Validation
Tooltip Independent

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.