
Atlas Antibodies Anti-IMPG1 Antibody
상품 한눈에 보기
Human IMPG1 단백질을 표적으로 하는 토끼 폴리클로날 항체로, IHC 독립 검증을 통해 단백질 발현을 확인함. 고순도 Affinity 정제 방식으로 제조되었으며, 인간에 대한 반응성이 검증됨. 시약 안정성을 위해 글리세롤 및 PBS 버퍼에 보존됨.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-IMPG1 Antibody
Target: Interphotoreceptor Matrix Proteoglycan 1 (IMPG1)
Supplier: Atlas Antibodies
Recommended Applications
Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein.
Product Description
Polyclonal antibody against human IMPG1.
Alternative Gene Names
GP147, IPM150, SPACR
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | Interphotoreceptor matrix proteoglycan 1 |
| Target Gene | IMPG1 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Verified Species Reactivity | Human |
| Interspecies Identity | Rat ENSRNOG00000012479 (60%), Mouse ENSMUSG00000032343 (54%) |
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet) |
Antigen Sequence
NERTEEAECRCKPGYDSQGSLDGLEPGLCGPGTKECEVLQGKGAPCRLPDHSENQAYKTSVKKFQNQQNNKVISKRNSELLTVEYEEFNHQDWEGNNotes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
Reference
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-IMPDH2 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-IMPG1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-IMPG1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-IMPACT Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-IMPAD1 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.