
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-IMPG1 Antibody
상품 한눈에 보기
Human IMPG1 단백질을 표적으로 하는 토끼 폴리클로날 항체로, IHC 독립 검증을 통해 단백질 발현을 확인함. 고순도 Affinity 정제 방식으로 제조되었으며, 인간에 대한 반응성이 검증됨. 시약 안정성을 위해 글리세롤 및 PBS 버퍼에 보존됨.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA030332-100 Anti-IMPG1 Antibody, interphotoreceptor matrix proteoglycan 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA030332-25 Anti-IMPG1 Antibody, interphotoreceptor matrix proteoglycan 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-IMPG1 Antibody
Anti-IMPG1 Antibody
Target: Interphotoreceptor Matrix Proteoglycan 1 (IMPG1)
Supplier: Atlas Antibodies
Recommended Applications
Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein.
Product Description
Polyclonal antibody against human IMPG1.
Alternative Gene Names
GP147, IPM150, SPACR
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | Interphotoreceptor matrix proteoglycan 1 |
| Target Gene | IMPG1 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Verified Species Reactivity | Human |
| Interspecies Identity | Rat ENSRNOG00000012479 (60%), Mouse ENSMUSG00000032343 (54%) |
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet) |
Antigen Sequence
NERTEEAECRCKPGYDSQGSLDGLEPGLCGPGTKECEVLQGKGAPCRLPDHSENQAYKTSVKKFQNQQNNKVISKRNSELLTVEYEEFNHQDWEGNNotes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
Reference
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



