
Atlas Antibodies Anti-IL1RN Antibody
상품 한눈에 보기
인간 IL1RN 단백질을 표적으로 하는 토끼 폴리클로날 항체. IHC 및 WB에 적합하며 RNA-seq 데이터 기반 정교한 정합 검증 수행. PrEST 항원으로 친화 정제되어 높은 특이성과 재현성을 제공. 다양한 조직에서의 IL1RN 발현 연구에 활용 가능.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-IL1RN Antibody
Target: Interleukin 1 receptor antagonist (IL1RN)
Supplier: Atlas Antibodies
Recommended Applications
- IHC (Orthogonal validation): Protein expression validated by comparison to RNA-seq data in tissues with high and low target expression.
- WB (Western Blot)
Product Description
Polyclonal antibody against human IL1RN.
Alternative Gene Names
ICIL-1RA, IL-1RN, IL1F3, IL1RA, IRAP, MGC10430
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | Interleukin 1 receptor antagonist |
| Target Gene | IL1RN |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Sequence | ETICRPSGRKSSKMQAFRIWDVNQKTFYLRNNQLVAGYLQGPNVNLEEKIDVVPIEPHALFLGIHGGKMCLSCVKSGDETRLQLEAVNITDLSENRKQDKRFAFIRSDSGPTTSFESAACPGWFLCTAMEADQPVSLTNMPDEGVMVTKF |
| Verified Species Reactivity | Human |
| Interspecies Identity | Mouse (ENSMUSG00000026981, 76%), Rat (ENSRNOG00000005871, 73%) |
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Information
| 항목 | 내용 |
|---|---|
| Composition | 40% glycerol and PBS (pH 7.2) |
| Preservative | 0.02% sodium azide |
| MSDS | Material Safety Data Sheet |
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Datasheet
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-IL1R2 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-IL1RAPL2 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-IL1RN Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-IL1RL2 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-IL1RL1 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.