AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-ZNF843 Antibody
상품 한눈에 보기
휴먼 ZNF843 단백질에 특이적인 폴리클로날 항체입니다. WB 및 IHC 실험에 적합하며, 재조합 발현 검증을 완료했습니다. 토끼에서 생산된 IgG 항체로, PrEST 항원을 이용해 친화 정제되었습니다. 글리세롤 기반 완충액에 보존되어 장기 보관이 용이합니다.
- 카탈로그번호
- HPA030912-xxx (2개 옵션)
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA030912-100 Anti-ZNF843 Antibody, zinc finger protein 843 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA030912-25 Anti-ZNF843 Antibody, zinc finger protein 843 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-ZNF843 Antibody
Anti-ZNF843 Antibody
Target: zinc finger protein 843 (ZNF843)
Type: Polyclonal Antibody
Host: Rabbit
Supplier: Atlas Antibodies
Recommended Applications
- IHC (Immunohistochemistry)
- WB (Western Blot) – Recombinant expression validation using target protein overexpression
Product Description
Polyclonal antibody against human ZNF843 (zinc finger protein 843).
Alternative Gene Names
- MGC46336
Antigen Information
Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence:
QLCCWLTKEHTLAEALRLSPVPAGFWGPVEADRPPANSHRRVCPFCCCSCGDSVNEKTSLSQRVLPHPGEKTCRGGSVESVSLA
Verified Species Reactivity
- Human
Interspecies Information
| Species | Gene ID | Sequence Identity |
|---|---|---|
| Mouse | ENSMUSG00000045598 | 25% |
| Rat | ENSRNOG00000016547 | 25% |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2) with 0.02% sodium azide |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Material Safety Data Sheet (MSDS)
Notes
- Gently mix before use.
- Optimal concentrations and conditions should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.