
Atlas Antibodies Anti-ZNF843 Antibody
상품 한눈에 보기
휴먼 ZNF843 단백질에 특이적인 폴리클로날 항체입니다. WB 및 IHC 실험에 적합하며, 재조합 발현 검증을 완료했습니다. 토끼에서 생산된 IgG 항체로, PrEST 항원을 이용해 친화 정제되었습니다. 글리세롤 기반 완충액에 보존되어 장기 보관이 용이합니다.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-ZNF843 Antibody
Target: zinc finger protein 843 (ZNF843)
Type: Polyclonal Antibody
Host: Rabbit
Supplier: Atlas Antibodies
Recommended Applications
- IHC (Immunohistochemistry)
- WB (Western Blot) – Recombinant expression validation using target protein overexpression
Product Description
Polyclonal antibody against human ZNF843 (zinc finger protein 843).
Alternative Gene Names
- MGC46336
Antigen Information
Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence:
QLCCWLTKEHTLAEALRLSPVPAGFWGPVEADRPPANSHRRVCPFCCCSCGDSVNEKTSLSQRVLPHPGEKTCRGGSVESVSLA
Verified Species Reactivity
- Human
Interspecies Information
| Species | Gene ID | Sequence Identity |
|---|---|---|
| Mouse | ENSMUSG00000045598 | 25% |
| Rat | ENSRNOG00000016547 | 25% |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2) with 0.02% sodium azide |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Material Safety Data Sheet (MSDS)
Notes
- Gently mix before use.
- Optimal concentrations and conditions should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-ZNF843 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-ZNF84 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-ZNF843 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-ZNF839 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-ZNF837 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.