
1 / 2
Atlas Antibodies Anti-ZNF843 Antibody
상품 한눈에 보기
휴먼 ZNF843(zinc finger protein 843)을 인식하는 폴리클로날 항체로, IHC 및 WB에 적합합니다. 재조합 단백질 기반으로 검증되었으며, 토끼에서 생산된 IgG 형태입니다. 고순도의 친화정제 방식으로 제조되어 높은 특이성과 재현성을 제공합니다.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-ZNF843 Antibody
Target: zinc finger protein 843 (ZNF843)
Supplier: Atlas Antibodies
Recommended Applications
- Immunohistochemistry (IHC)
- Western Blot (WB, Recombinant Expression Validation)
Recombinant expression validation in WB using target protein overexpression.
Product Description
Polyclonal antibody against human ZNF843.
Alternative Gene Names
- MGC46336
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | zinc finger protein 843 |
| Target Gene | ZNF843 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Epitope Sequence | QLCCWLTKEHTLAEALRLSPVPAGFWGPVEADRPPANSHRRVCPFCCCSCGDSVNEKTSLSQRVLPHPGEKTCRGGSVESVSLA |
| Verified Species Reactivity | Human |
| Interspecies Information | Mouse ENSMUSG00000045598 (25%), Rat ENSRNOG00000016547 (25%) |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Material Safety Data Sheet (MSDS)
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-ZNF843 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-ZNF831 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-ZNF843 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-ZNF84 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-ZNF843 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.