
Atlas Antibodies Anti-ZNF710 Antibody
상품 한눈에 보기
휴먼 ZNF710 단백질을 인식하는 폴리클로날 항체로, IHC를 통한 단백질 발현 정량 검증에 적합합니다. Rabbit 유래 IgG 항체이며, PrEST 항원을 이용해 친화 정제되었습니다. 인간 시료에 최적화되어 있으며, RNA-seq 데이터와 비교한 Orthogonal validation이 수행되었습니다.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-ZNF710 Antibody
Target: Zinc finger protein 710 (ZNF710)
Supplier: Atlas Antibodies
Recommended Applications
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
Product Description
Polyclonal antibody against human ZNF710.
Alternative Gene Names
DKFZp547K1113, FLJ00306, FLJ37393
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | Zinc finger protein 710 |
| Target Gene | ZNF710 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Epitope Sequence | KVKFEKVEEEEQEVYEVSVPGDDKDAGPAEAPAEAASGGCDALVQSSAVKMIDLSAFSRKPRTLRHLPRTP |
Species Reactivity
| 항목 | 내용 |
|---|---|
| Verified Species Reactivity | Human |
| Interspecies Information | Highest antigen sequence identity to: • Rat ENSRNOG00000014278 (93%) • Mouse ENSMUSG00000048897 (92%) |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Information
| 항목 | 내용 |
|---|---|
| Buffer Composition | 40% glycerol and PBS (pH 7.2) |
| Preservative | 0.02% sodium azide |
| Safety Information | Material Safety Data Sheet |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-ZNF713 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-ZNF710 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-ZNF710 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-ZNF709 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-ZNF713 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.