
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-ZNF709 Antibody
상품 한눈에 보기
인간 ZNF709 단백질을 인식하는 폴리클로날 항체로, Rabbit에서 생산됨. 면역세포화학 등 다양한 응용에 적합. PrEST 항원을 이용한 친화 정제 방식으로 높은 특이성과 재현성 제공. Human에 반응하며 Mouse, Rat과 부분적 상동성 보유.
- 카탈로그번호
- HPA045573-xxx (2개 옵션)
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA045573-100 Anti-ZNF709 Antibody, zinc finger protein 709 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA045573-25 Anti-ZNF709 Antibody, zinc finger protein 709 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-ZNF709 Antibody
Anti-ZNF709 Antibody
Target Information
- Target Protein: Zinc finger protein 709
- Target Gene: ZNF709
- Alternative Gene Names: FLJ38281
Product Description
Polyclonal antibody against Human ZNF709.
Antigen Information
- Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
LQSLSAVTSSDQRRRSKEARTPGTRDTDSVVFED
Verified Species Reactivity
- Human
Interspecies Information
Highest antigen sequence identity to the following orthologs:
- Mouse ENSMUSG00000079620 (44%)
- Rat ENSRNOG00000024365 (38%)
Recommended Applications
- Immunocytochemistry (ICC)
Specifications
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Material Safety Data Sheet
Open Datasheet
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



