
Atlas Antibodies Anti-ZNF232 Antibody
Human ZNF232(zinc finger protein 232)를 인식하는 rabbit polyclonal antibody. IHC 및 WB에 적합. PrEST 항원을 이용한 affinity purification으로 높은 특이성과 재현성 확보. Human에 대해 검증된 반응성.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-ZNF232 Antibody
Target: Zinc finger protein 232
Supplier: Atlas Antibodies
Recommended Applications
- Immunohistochemistry (IHC)
- Western Blot (WB)
Product Description
Polyclonal antibody against human ZNF232 (zinc finger protein 232).
Alternative Gene Names
- ZSCAN11
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | Zinc finger protein 232 |
| Target Gene | ZNF232 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Verified Species Reactivity | Human |
| Interspecies Identity | Mouse ENSMUSG00000037017 (41%), Rat ENSRNOG00000059552 (40%) |
Antigen Sequence (PrEST):
SWYEPSAELVQTRMAVSLTAAETLALQGTQGQEKMMMMGPKEEEQSCEYETRLPGNHSTSQEIFRQRFRHLRYQETPGPREALSQLRVLCCEWLRPEKHTKEQILEFL
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Composition
40% glycerol and PBS (pH 7.2).
0.02% sodium azide added as preservative.
Material Safety Data Sheet
Notes
Gently mix before use.
Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-ZNF230 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-ZNF229 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-ZNF232 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-ZNF236 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-ZNF235 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|